OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ATG5 (NM_004849) Human Mass Spec Standard

Be the first to review this product
SKU
PH310563
ATG5 MS Standard C13 and N15-labeled recombinant protein (NP_004840)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA301481 Rabbit Polyclonal Antibody against ATG5
100 ul
$680.00
LY401532 Transient overexpression lysate of ATG5 autophagy related 5 homolog (S. cerevisiae) (ATG5) (as WB positive control) 100 ug
$436.00

Other products for "ATG5 or NM_004849"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC210563
Predicted MW 32.4 kDa
Protein Sequence
Protein Sequence
>RC210563 protein sequence
Red=Cloning site Green=Tags(s)

MTDDKDVLRDVWFGRIPTCFTLYQDEITEREAEPYYLLLPRVSYLTLVTDKVKKHFQKVMRQEDISEIWF
EYEGTPLKWHYPIGLLFDLLASSSALPWNITVHFKSFPEKDLLHCPSKDAIEAHFMSCMKEADALKHKSQ
VINEMQKKDHKQLWMGLQNDRFDQFWAINRKLMEYPAEENGFRYIPFRIYQTTTERPFIQKLFRPVAADG
QLHTLGDLLKEVCPSAIDPEDGEKKNQVMIHGIEPMLETPLQWLSEHLSYPDNFLHISIIPQPTD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004840
RefSeq Size 3260
RefSeq ORF 825
Synonyms APG5; APG5-LIKE; APG5L; ASP; hAPG5; SCAR25
Locus ID 9474
UniProt ID Q9H1Y0
Cytogenetics 6q21
Summary The protein encoded by this gene, in combination with autophagy protein 12, functions as an E1-like activating enzyme in a ubiquitin-like conjugating system. The encoded protein is involved in several cellular processes, including autophagic vesicle formation, mitochondrial quality control after oxidative damage, negative regulation of the innate antiviral immune response, lymphocyte development and proliferation, MHC II antigen presentation, adipocyte differentiation, and apoptosis. Several transcript variants encoding different protein isoforms have been found for this gene. provided by RefSeq, Sep 2015
Protein Families Druggable Genome
Protein Pathways Regulation of autophagy, RIG-I-like receptor signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ATG5" proteins (4)
SKU Description Size Price
LC401532 Lyophilized ATG5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401532 Transient overexpression lysate of ATG5 autophagy related 5 homolog (S. cerevisiae) (ATG5) (as WB positive control) 100 ug
$436.00
TP310563 Recombinant protein of human ATG5 autophagy related 5 homolog (S. cerevisiae) (ATG5), 20 µg 20 ug
$867.00
TP720995 Purified recombinant protein of Human ATG5 autophagy related 5 homolog (S. cerevisiae) (ATG5) 10 ug
$275.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products