OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ANKRD2 (NM_020349) Human Mass Spec Standard

Be the first to review this product
SKU
PH310468
ANKRD2 MS Standard C13 and N15-labeled recombinant protein (NP_065082)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA344170 Rabbit Polyclonal Anti-ANKRD2 Antibody
100 ul
$585.00
LY412545 Transient overexpression lysate of ankyrin repeat domain 2 (stretch responsive muscle) (ANKRD2), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "ANKRD2 or NM_020349"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC210468
Predicted MW 39.9 kDa
Protein Sequence
Protein Sequence
>RC210468 protein sequence
Red=Cloning site Green=Tags(s)

MAKAPSWAGVGALAYKAPEALWPAEAVMDGTMEDSEAVQRATALIEQRLAQEEENEKLRGDARQKLPMDL
LVLEDEKHHGAQSAALQKVKGQERVRKTSLDLRREIIDVGGIQNLIELRKKRKQKKRDALAASHEPPPEP
EEITGPVDEETFLKAAVEGKMKVIEKFLADGGSADTCDQFRRTALHRASLEGHMEILEKLLDNGATVDFQ
DRLDCTAMHWACRGGHLEVVKLLQSHGADTNVRDKLLSTPLHVAVRTGQVEIVEHFLSLGLEINARDREG
DTALHDAVRLNRYKIIKLLLLHGADMMTKNLAGKTPTDLVQLWQADTRHALEHPEPGAEHNGLEGPNDSG
RETPQPVPAQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_065082
RefSeq Size 1520
RefSeq ORF 1080
Synonyms ARPP
Locus ID 26287
UniProt ID Q9GZV1
Cytogenetics 10q24.2
Summary This gene encodes a protein that belongs to the muscle ankyrin repeat protein (MARP) family. A similar gene in rodents is a component of a muscle stress response pathway and plays a role in the stretch-response associated with slow muscle function. Alternative splicing results in multiple transcript variants encoding different isoforms. provided by RefSeq, Mar 2014
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ANKRD2" proteins (7)
SKU Description Size Price
PH325475 ANKRD2 MS Standard C13 and N15-labeled recombinant protein (NP_001123453) 10 ug
$3,360.00
LC412545 Lyophilized ANKRD2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427086 Lyophilized ANKRD2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY412545 Transient overexpression lysate of ankyrin repeat domain 2 (stretch responsive muscle) (ANKRD2), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY427086 Transient overexpression lysate of ankyrin repeat domain 2 (stretch responsive muscle) (ANKRD2), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP310468 Recombinant protein of human ankyrin repeat domain 2 (stretch responsive muscle) (ANKRD2), transcript variant 1, 20 µg 20 ug
$867.00
TP325475 Purified recombinant protein of Homo sapiens ankyrin repeat domain 2 (stretch responsive muscle) (ANKRD2), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products