OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

IAH1 (NM_001039613) Human Mass Spec Standard

Be the first to review this product
SKU
PH310341
IAH1 MS Standard C13 and N15-labeled recombinant protein (NP_001034702)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA357171 IAH1 Antibody - N-terminal region
100 ul
$585.00
LY422089 Transient overexpression lysate of isoamyl acetate-hydrolyzing esterase 1 homolog (S. cerevisiae) (IAH1) (as WB positive control) 100 ug
$436.00

Other products for "IAH1 or NM_001039613"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC210341
Predicted MW 27.6 kDa
Protein Sequence
Protein Sequence
>RC210341 protein sequence
Red=Cloning site Green=Tags(s)

MALCEAAGCGSALLWPRLLLFGDSITQFSFQQGGWGASLADRLVRKCDVLNRGFSGYNTRWAKIILPRLI
RKGNSLDIPVAVTIFFGANDSALKDENPKQHIPLEEYAANLKSMVQYLKSVDIPENRVILITPTPLCETA
WEEQCIIQGCKLNRLNSVVGEYANACLQVAQDCGTDVLDLWTLMQDSQDFSSYLSDGLHLSPKGNEFLFS
HLWPLIEKKVSSLPLLLPYWRDVAEAKPELSLLGDGDH

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001034702
RefSeq Size 951
RefSeq ORF 744
Locus ID 285148
UniProt ID Q2TAA2
Cytogenetics 2p25.1
Summary Probable lipase.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "IAH1" proteins (3)
SKU Description Size Price
LC422089 Lyophilized IAH1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY422089 Transient overexpression lysate of isoamyl acetate-hydrolyzing esterase 1 homolog (S. cerevisiae) (IAH1) (as WB positive control) 100 ug
$436.00
TP310341 Recombinant protein of human isoamyl acetate-hydrolyzing esterase 1 homolog (S. cerevisiae) (IAH1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products