PRKACA (NM_002730) Human Mass Spec Standard
CAT#: PH310332
PRKACA MS Standard C13 and N15-labeled recombinant protein (NP_002721)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210332 |
Predicted MW | 40.4 kDa |
Protein Sequence |
>RC210332 representing NM_002730
Red=Cloning site Green=Tags(s) MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHY AMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFS EPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEI ILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTK RFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSE F myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_002721 |
RefSeq Size | 2689 |
RefSeq ORF | 1053 |
Synonyms | CAFD1; PKACA; PPNAD4 |
Locus ID | 5566 |
UniProt ID | P17612, A0A024R7J0 |
Cytogenetics | 19p13.12 |
Summary | This gene encodes one of the catalytic subunits of protein kinase A, which exists as a tetrameric holoenzyme with two regulatory subunits and two catalytic subunits, in its inactive form. cAMP causes the dissociation of the inactive holoenzyme into a dimer of regulatory subunits bound to four cAMP and two free monomeric catalytic subunits. Four different regulatory subunits and three catalytic subunits have been identified in humans. cAMP-dependent phosphorylation of proteins by protein kinase A is important to many cellular processes, including differentiation, proliferation, and apoptosis. Constitutive activation of this gene caused either by somatic mutations, or genomic duplications of regions that include this gene, have been associated with hyperplasias and adenomas of the adrenal cortex and are linked to corticotropin-independent Cushing's syndrome. Alternative splicing results in multiple transcript variants encoding different isoforms. Tissue-specific isoforms that differ at the N-terminus have been described, and these isoforms may differ in the post-translational modifications that occur at the N-terminus of some isoforms. [provided by RefSeq, Jan 2015] |
Protein Families | Druggable Genome, Protein Kinase |
Protein Pathways | Apoptosis, Calcium signaling pathway, Chemokine signaling pathway, Dilated cardiomyopathy, Gap junction, GnRH signaling pathway, Hedgehog signaling pathway, Insulin signaling pathway, Long-term potentiation, MAPK signaling pathway, Melanogenesis, Olfactory transduction, Oocyte meiosis, Prion diseases, Progesterone-mediated oocyte maturation, Taste transduction, Vascular smooth muscle contraction, Vibrio cholerae infection, Wnt signaling pathway |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403918 | PRKACA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC419140 | PRKACA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY403918 | Transient overexpression lysate of protein kinase, cAMP-dependent, catalytic, alpha (PRKACA), transcript variant 2 |
USD 436.00 |
|
LY419140 | Transient overexpression lysate of protein kinase, cAMP-dependent, catalytic, alpha (PRKACA), transcript variant 1 |
USD 436.00 |
|
PH320877 | PRKACA MS Standard C13 and N15-labeled recombinant protein (NP_997401) |
USD 3,255.00 |
|
TP310332 | Recombinant protein of human protein kinase, cAMP-dependent, catalytic, alpha (PRKACA), transcript variant 1, 20 µg |
USD 867.00 |
|
TP320877 | Recombinant protein of human protein kinase, cAMP-dependent, catalytic, alpha (PRKACA), transcript variant 2, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review