OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SOX18 (NM_018419) Human Mass Spec Standard

Be the first to review this product
SKU
PH310323
SOX18 MS Standard C13 and N15-labeled recombinant protein (NP_060889)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA331858 Rabbit Polyclonal Anti-SOX18 Antibody
100 ul
$585.00
LY413065 Transient overexpression lysate of SRY (sex determining region Y)-box 18 (SOX18) (as WB positive control) 100 ug
$436.00

Other products for "SOX18 or NM_018419"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC210323
Predicted MW 40.7 kDa
Protein Sequence
Protein Sequence
>RC210323 representing NM_018419
Red=Cloning site Green=Tags(s)

MQRSPPGYGAQDDPPARRDCAWAPGHGAAADTRGLAAGPAALAAPAAPASPPSPQRSPPRSPEPGRYGLS
PAGRGERQAADESRIRRPMNAFMVWAKDERKRLAQQNPDLHNAVLSKMLGKAWKELNAAEKRPFVEEAER
LRVQHLRDHPNYKYRPRRKKQARKARRLEPGLLLPGLAPPQPPPEPFPAASGSARAFRELPPLGAEFDGL
GLPTPERSPLDGLEPGEAAFFPPPAAPEDCALRPFRAPYAPTELSRDPGGCYGAPLAEALRTAPPAAPLA
GLYYGTLGTPGPYPGPLSPPPEAPPLESAEPLGPAADLWADVDLTEFDQYLNCSRTRPDAPGLPYHVALA
KLGPRAMSCPEESSLISALSDASSAVYYSACISGSGP

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060889
RefSeq Size 1718
RefSeq ORF 1161
Synonyms HLTRS; HLTS
Locus ID 54345
UniProt ID P35713
Cytogenetics 20q13.33
Summary This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. This protein plays a role in hair, blood vessel, and lymphatic vessel development. Mutations in this gene have been associated with recessive and dominant forms of hypotrichosis-lymphedema-telangiectasia. provided by RefSeq, Jul 2008
Protein Families Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SOX18" proteins (3)
SKU Description Size Price
LC413065 Lyophilized SOX18 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY413065 Transient overexpression lysate of SRY (sex determining region Y)-box 18 (SOX18) (as WB positive control) 100 ug
$436.00
TP310323 Recombinant protein of human SRY (sex determining region Y)-box 18 (SOX18), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products