OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SHARP2 (BHLHE40) (NM_003670) Human Mass Spec Standard

Be the first to review this product
SKU
PH310294
BHLHE40 MS Standard C13 and N15-labeled recombinant protein (NP_003661)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA810228 BHLHE40 mouse monoclonal antibody,clone OTI10H1 100 ul
$447.00
LY418509 Transient overexpression lysate of basic helix-loop-helix family, member e40 (BHLHE40) (as WB positive control) 100 ug
$436.00

Other products for "SHARP2 or NM_003670"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC210294
Predicted MW 45.5 kDa
Protein Sequence
Protein Sequence
>RC210294 protein sequence
Red=Cloning site Green=Tags(s)

MERIPSAQPPPACLPKAPGLEHGDLPGMYPAHMYQVYKSRRGIKRSEDSKETYKLPHRLIEKKRRDRINE
CIAQLKDLLPEHLKLTTLGHLEKAVVLELTLKHVKALTNLIDQQQQKIIALQSGLQAGELSGRNVETGQE
MFCSGFQTCAREVLQYLAKHENTRDLKSSQLVTHLHRVVSELLQGGTSRKPSDPAPKVMDFKEKPSSPAK
GSEGPGKNCVPVIQRTFAHSSGEQSGSDTDTDSGYGGESEKGDLRSEQPCFKSDHGRRFTMGERIGAIKQ
ESEEPPTKKNRMQLSDDEGHFTSSDLISSPFLGPHPHQPPFCLPFYLIPPSATAYLPMLEKCWYPTSVPV
LYPGLNASAAALSSFMNPDKISAPLLMPQRLPSPLPAHPSVDSSVLLQALKPIPPLNLETKD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003661
RefSeq Size 3061
RefSeq ORF 1236
Synonyms BHLHB2; Clast5; DEC1; HLHB2; SHARP-2; SHARP2; STRA13; Stra14
Locus ID 8553
UniProt ID O14503
Cytogenetics 3p26.1
Summary This gene encodes a basic helix-loop-helix protein expressed in various tissues. The encoded protein can interact with ARNTL or compete for E-box binding sites in the promoter of PER1 and repress CLOCK/ARNTL's transactivation of PER1. This gene is believed to be involved in the control of circadian rhythm and cell differentiation. provided by RefSeq, Feb 2014
Protein Families Transcription Factors
Protein Pathways Circadian rhythm - mammal
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SHARP2" proteins (3)
SKU Description Size Price
LC418509 Lyophilized BHLHE40 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418509 Transient overexpression lysate of basic helix-loop-helix family, member e40 (BHLHE40) (as WB positive control) 100 ug
$436.00
TP310294 Recombinant protein of human basic helix-loop-helix family, member e40 (BHLHE40), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products