OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DSCR4 (NM_005867) Human Mass Spec Standard

Be the first to review this product
SKU
PH310247
DSCR4 MS Standard C13 and N15-labeled recombinant protein (NP_005858)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY417009 Transient overexpression lysate of Down syndrome critical region gene 4 (DSCR4) (as WB positive control) 100 ug
$436.00

Other products for "DSCR4 or NM_005867"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC210247
Predicted MW 13 kDa
Protein Sequence
Protein Sequence
>RC210247 protein sequence
Red=Cloning site Green=Tags(s)

MSLIILTRDDEPRIFTPDSDAASPALHSTSPLPDPASASPLHREEKILPKVCNIVSCLSFSLPASPTDSG
LASPTIITREGQQFWAKCLIWKYQLYLHGLHKKSDGRRDKQISASPST

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005858
RefSeq Size 1102
RefSeq ORF 354
Synonyms DCRB; DSCRB
Locus ID 10281
Cytogenetics 21q22.13
Summary The gene is found in a region of chromosome 21 that has been linked to the pathogenesis of Down syndrome. This gene is transcribed from a bi-directional promoter located in an endogenous retrovirus. provided by RefSeq, Jan 2015
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "DSCR4" proteins (3)
SKU Description Size Price
LC417009 Lyophilized DSCR4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY417009 Transient overexpression lysate of Down syndrome critical region gene 4 (DSCR4) (as WB positive control) 100 ug
$436.00
TP310247 Recombinant protein of human Down syndrome critical region gene 4 (DSCR4), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products