OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PAEP (NM_002571) Human Mass Spec Standard

Be the first to review this product
SKU
PH310121
PAEP MS Standard C13 and N15-labeled recombinant protein (NP_002562)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY419242 Transient overexpression lysate of progestagen-associated endometrial protein (PAEP), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "PAEP or NM_002571"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC210121
Predicted MW 20.6 kDa
Protein Sequence
Protein Sequence
>RC210121 protein sequence
Red=Cloning site Green=Tags(s)

MLCLLLTLGVALVCGVPAMDIPQTKQDLELPKLAGTWHSMAMATNNISLMATLKAPLRVHITSLLPTPED
NLEIVLHRWENNSCVEKKVLGEKTENPKKFKINYTVANEATLLDTDYDNFLFLCLQDTTTPIQSMMCQYL
ARVLVEDDEIMQGFIRAFRPLPRHLWYLLDLKQMEEPCRF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002562
RefSeq Size 828
RefSeq ORF 540
Synonyms GD; GdA; GdF; GdS; PAEG; PEP; PP14; ZIF-1
Locus ID 5047
UniProt ID P09466
Cytogenetics 9q34.3
Summary This gene is a member of the kernel lipocalin superfamily whose members share relatively low sequence similarity but have highly conserved exon/intron structure and three-dimensional protein folding. Most lipocalins are clustered on the long arm of chromosome 9. The encoded glycoprotein has been previously referred to as pregnancy-associated endometrial alpha-2-globulin, placental protein 14, and glycodelin, but has been officially named progestagen-associated endometrial protein. Three distinct forms, with identical protein backbones but different glycosylation profiles, are found in amniotic fluid, follicular fluid and seminal plasma of the reproductive system. These glycoproteins have distinct and essential roles in regulating a uterine environment suitable for pregnancy and in the timing and occurrence of the appropriate sequence of events in the fertilization process. Alternative splicing results in multiple transcript variants. provided by RefSeq, Oct 2015
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PAEP" proteins (5)
SKU Description Size Price
LC419242 Lyophilized PAEP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422704 Lyophilized PAEP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY419242 Transient overexpression lysate of progestagen-associated endometrial protein (PAEP), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY422704 Transient overexpression lysate of progestagen-associated endometrial protein (PAEP), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP310121 Recombinant protein of human progestagen-associated endometrial protein (PAEP), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products