PAEP (NM_002571) Human Tagged ORF Clone

SKU
RC210121
PAEP (Myc-DDK-tagged)-Human progestagen-associated endometrial protein (PAEP), transcript variant 2
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol PAEP
Synonyms GD; GdA; GdF; GdS; PAEG; PEP; PP14; ZIF-1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC210121 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGTGCCTCCTGCTCACCCTGGGCGTGGCCCTGGTCTGTGGTGTCCCGGCCATGGACATCCCCCAGA
CCAAGCAGGACCTGGAGCTCCCAAAGTTGGCAGGGACCTGGCACTCCATGGCCATGGCGACCAACAACAT
CTCCCTCATGGCGACACTGAAGGCCCCTCTGAGGGTCCACATCACCTCACTGTTGCCCACCCCCGAGGAC
AACCTGGAGATCGTTCTGCACAGATGGGAGAACAACAGCTGTGTTGAGAAGAAGGTCCTTGGAGAGAAGA
CTGAGAATCCAAAGAAGTTCAAGATCAACTATACGGTGGCGAACGAGGCCACGCTGCTCGATACTGACTA
CGACAATTTCCTGTTTCTCTGCCTACAGGACACCACCACCCCCATCCAGAGCATGATGTGCCAGTACCTG
GCCAGAGTCCTGGTGGAGGACGATGAGATCATGCAGGGATTCATCAGGGCTTTCAGGCCCCTGCCCAGGC
ACCTATGGTACTTGCTGGACTTGAAACAGATGGAAGAGCCGTGCCGTTTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC210121 protein sequence
Red=Cloning site Green=Tags(s)

MLCLLLTLGVALVCGVPAMDIPQTKQDLELPKLAGTWHSMAMATNNISLMATLKAPLRVHITSLLPTPED
NLEIVLHRWENNSCVEKKVLGEKTENPKKFKINYTVANEATLLDTDYDNFLFLCLQDTTTPIQSMMCQYL
ARVLVEDDEIMQGFIRAFRPLPRHLWYLLDLKQMEEPCRF

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_002571
ORF Size 540 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_002571.4
RefSeq Size 828 bp
RefSeq ORF 543 bp
Locus ID 5047
UniProt ID P09466
Cytogenetics 9q34.3
Protein Families Druggable Genome
MW 20.6 kDa
Summary This gene is a member of the kernel lipocalin superfamily whose members share relatively low sequence similarity but have highly conserved exon/intron structure and three-dimensional protein folding. Most lipocalins are clustered on the long arm of chromosome 9. The encoded glycoprotein has been previously referred to as pregnancy-associated endometrial alpha-2-globulin, placental protein 14, and glycodelin, but has been officially named progestagen-associated endometrial protein. Three distinct forms, with identical protein backbones but different glycosylation profiles, are found in amniotic fluid, follicular fluid and seminal plasma of the reproductive system. These glycoproteins have distinct and essential roles in regulating a uterine environment suitable for pregnancy and in the timing and occurrence of the appropriate sequence of events in the fertilization process. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2015]
Write Your Own Review
You're reviewing:PAEP (NM_002571) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC210121L3 Lenti ORF clone of Human progestagen-associated endometrial protein (PAEP), transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC210121L4 Lenti ORF clone of Human progestagen-associated endometrial protein (PAEP), transcript variant 2, mGFP tagged 10 ug
$600.00
RG210121 PAEP (tGFP-tagged) - Human progestagen-associated endometrial protein (PAEP), transcript variant 2 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC303222 PAEP (untagged)-Human progestagen-associated endometrial protein (PAEP), transcript variant 2 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.