MIOX (NM_017584) Human Mass Spec Standard

CAT#: PH310070

MIOX MS Standard C13 and N15-labeled recombinant protein (NP_060054)

Product Images

Coomassie blue staining of purified MIOX protein (Cat# TP310070). The protein was produced from HEK293T cells transfected with MIOX cDNA clone (Cat# RC210070) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC210070
• Predicted MW: 33 kDa
• Protein Sequence:
  Sequence Link

  >RC210070 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKVTVGPDPSLVYRPDVDPEVAKDKASFRNYTSGPLLDRVFTTYKLMHTHQTVDFVRSKHAQFGGFSYKK
  MTVMEAVDLLDGLVDESDPDVDFPNSFHAFQTAEGIRKAHPDKDWFHLVGLLHDLGKVLALFGEPQWAVV
  GDTFPVGCRPQASVVFCDSTFQDNPDLQDPRYSTELGMYQPHCGLDRVLMSWGHDEYMYQVMKFNKFSLP
  PEAFYMIRFHSFYPWHTGRDYQQLCSQQDLAMLPWVREFNKFDLYTKCPDLPDVDKLRPYYQGLIDKYCP
  GILSW
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_060054
• RefSeq Size: 1437
• RefSeq ORF: 855
• Synonyms: ALDRL6
• Locus ID: 55586
• UniProt ID: Q9UGB7
• Cytogenetics: 22q13.33
• Protein Pathways: Ascorbate and aldarate metabolism, Inositol phosphate metabolism