OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PRAP1 (NM_145202) Human Mass Spec Standard

Be the first to review this product
SKU
PH310031
PRAP1 MS Standard C13 and N15-labeled recombinant protein (NP_660203)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA357450 PRAP1 Antibody - C-terminal region
100 ul
$585.00
LY407941 Transient overexpression lysate of proline-rich acidic protein 1 (PRAP1), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "PRAP1 or NM_145202"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC210031
Predicted MW 17.2 kDa
Protein Sequence
Protein Sequence
>RC210031 protein sequence
Red=Cloning site Green=Tags(s)

MRRLLLVTSLVVVLLWEAGAVPAPKVPIKMQVKHWPSEQDPEKAWGARVVEPPEKDDQLVVLFPVQKPKL
LTTEEKPRGQGRGPILPGTKAWMETEDTLGRVLSPEPDHDSLYHPPPEEDQGEERPRLWVMPNHQVLLGP
EEDQDHIYHPQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_660203
RefSeq Size 807
RefSeq ORF 453
Synonyms PRO1195; UPA
Locus ID 118471
UniProt ID Q96NZ9
Cytogenetics 10q26.3
Summary May play an important role in maintaining normal growth homeostasis in epithelial cells.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PRAP1" proteins (7)
SKU Description Size Price
PH327420 PRAP1 MS Standard C13 and N15-labeled recombinant protein (NP_001138673) 10 ug
$3,360.00
LC407941 Lyophilized PRAP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428749 Lyophilized PRAP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY407941 Transient overexpression lysate of proline-rich acidic protein 1 (PRAP1), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY428749 Transient overexpression lysate of proline-rich acidic protein 1 (PRAP1), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP310031 Recombinant protein of human proline-rich acidic protein 1 (PRAP1), transcript variant 1, 20 µg 20 ug
$867.00
TP327420 Purified recombinant protein of Homo sapiens proline-rich acidic protein 1 (PRAP1), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products