OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

POLD4 (NM_021173) Human Mass Spec Standard

Be the first to review this product
SKU
PH309992
POLD4 MS Standard C13 and N15-labeled recombinant protein (NP_066996)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA380121 POLD4 Rabbit polyclonal Antibody
100 ul
$410.00
LY412048 Transient overexpression lysate of polymerase (DNA-directed), delta 4 (POLD4) (as WB positive control) 100 ug
$436.00

Other products for "POLD4 or NM_021173"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC209992
Predicted MW 12.4 kDa
Protein Sequence
Protein Sequence
>RC209992 protein sequence
Red=Cloning site Green=Tags(s)

MGRKRLITDSYPVVKRREGPAGHSKGELAPELGEEPQPRDEEEAELELLRQFDLAWQYGPCTGITRLQRW
CRAKHMGLEPPPEVWQVLKTHPGDPRFQCSLWHLYPL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_066996
RefSeq Size 1751
RefSeq ORF 321
Synonyms p12; POLDS
Locus ID 57804
UniProt ID Q9HCU8
Cytogenetics 11q13.2
Summary This gene encodes the smallest subunit of DNA polymerase delta. DNA polymerase delta possesses both polymerase and 3' to 5' exonuclease activity and plays a critical role in DNA replication and repair. The encoded protein enhances the activity of DNA polymerase delta and plays a role in fork repair and stabilization through interactions with the DNA helicase Bloom syndrome protein. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. provided by RefSeq, Mar 2012
Protein Pathways Base excision repair, DNA replication, Homologous recombination, Metabolic pathways, Mismatch repair, Nucleotide excision repair, Purine metabolism, Pyrimidine metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "POLD4" proteins (3)
SKU Description Size Price
LC412048 Lyophilized POLD4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY412048 Transient overexpression lysate of polymerase (DNA-directed), delta 4 (POLD4) (as WB positive control) 100 ug
$436.00
TP309992 Recombinant protein of human polymerase (DNA-directed), delta 4 (POLD4), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products