OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

AK2 (NM_001625) Human Mass Spec Standard

Be the first to review this product
SKU
PH309974
AK2 MS Standard C13 and N15-labeled recombinant protein (NP_001616)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA349614 Rabbit Polyclonal Anti-AK2 Antibody
100 ul
$205.00
LY415600 Transient overexpression lysate of adenylate kinase 2 (AK2), transcript variant AK2B (as WB positive control) 100 ug
$436.00

Other products for "AK2 or NM_001625"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC209974
Predicted MW 26.5 kDa
Protein Sequence
Protein Sequence
>RC209974 protein sequence
Red=Cloning site Green=Tags(s)

MAPSVPAAEPEYPKGIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDA
GKLVSDEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRIT
GRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQAYHTQTTPLIEYYRKRGIHSAI
DASQTPDVVFASILAAFSKATCKDLVMFI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001616
RefSeq Size 2759
RefSeq ORF 717
Synonyms ADK2
Locus ID 204
UniProt ID P54819
Cytogenetics 1p35.1
Summary Adenylate kinases are involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate groups among adenine nucleotides. Three isozymes of adenylate kinase, namely 1, 2, and 3, have been identified in vertebrates; this gene encodes isozyme 2. Expression of these isozymes is tissue-specific and developmentally regulated. Isozyme 2 is localized in the mitochondrial intermembrane space and may play a role in apoptosis. Mutations in this gene are the cause of reticular dysgenesis. Alternate splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 1 and 2.provided by RefSeq, Nov 2010
Protein Families Druggable Genome
Protein Pathways Metabolic pathways, Purine metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "AK2" proteins (5)
SKU Description Size Price
LC415600 Lyophilized AK2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC419835 Lyophilized AK2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415600 Transient overexpression lysate of adenylate kinase 2 (AK2), transcript variant AK2B (as WB positive control) 100 ug
$436.00
LY419835 Transient overexpression lysate of adenylate kinase 2 (AK2), transcript variant AK2A (as WB positive control) 100 ug
$436.00
TP309974 Recombinant protein of human adenylate kinase 2 (AK2), transcript variant AK2A, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products