OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DNAJC19 (NM_145261) Human Mass Spec Standard

Be the first to review this product
SKU
PH309910
DNAJC19 MS Standard C13 and N15-labeled recombinant protein (NP_660304)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA375532 DNAJC19 Rabbit polyclonal Antibody
100 ul
$410.00
LY407987 Transient overexpression lysate of DnaJ (Hsp40) homolog, subfamily C, member 19 (DNAJC19) (as WB positive control) 100 ug
$436.00

Other products for "DNAJC19 or NM_145261"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC209910
Predicted MW 12.5 kDa
Protein Sequence
Protein Sequence
>RC209910 protein sequence
Red=Cloning site Green=Tags(s)

MASTVVAVGLTIAAAGFAGRYVLQAMKHMEPQVKQVFQSLPKSAFSGGYYRGGFEPKMTKREAALILGVS
PTANKGKIRDAHRRIMLLNHPDKGGSPYIAAKINEAKDLLEGQAKK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_660304
RefSeq Size 1476
RefSeq ORF 348
Synonyms PAM18; TIM14; TIMM14
Locus ID 131118
UniProt ID Q96DA6
Cytogenetics 3q26.33
Summary The protein encoded by this gene is thought to be part of a complex involved in the ATP-dependent transport of transit peptide-containing proteins from the inner cell membrane to the mitochondrial matrix. Defects in this gene are a cause of 3-methylglutaconic aciduria type 5 (MGA5), also known as dilated cardiomyopathy with ataxia (DCMA). Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 1, 2, 6, 10, 14 and 19. provided by RefSeq, Jan 2012
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "DNAJC19" proteins (3)
SKU Description Size Price
LC407987 Lyophilized DNAJC19 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY407987 Transient overexpression lysate of DnaJ (Hsp40) homolog, subfamily C, member 19 (DNAJC19) (as WB positive control) 100 ug
$436.00
TP309910 Recombinant protein of human DnaJ (Hsp40) homolog, subfamily C, member 19 (DNAJC19), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products