OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Tropomyosin 3 (TPM3) (NM_153649) Human Mass Spec Standard

Be the first to review this product
SKU
PH309904
TPM3 MS Standard C13 and N15-labeled recombinant protein (NP_705935)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA326995 TPM3 Rabbit Polyclonal Antibody
100 ul
$410.00
LY407004 Transient overexpression lysate of tropomyosin 3 (TPM3), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "Tropomyosin 3 or NM_153649"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC209904
Predicted MW 28.9 kDa
Protein Sequence
Protein Sequence
>RC209904 representing NM_153649
Red=Cloning site Green=Tags(s)

MAGITTIEAVKRKIQVLQQQADDAEERAERLQREVEGERRAREQAEAEVASLNRRIQLVEEELDRAQERL
ATALQKLEEAEKAADESERGMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDL
ERTEERAELAESRCREMDEQIRLMDQNLKCLSAAEEKYSQKEDKYEEEIKILTDKLKEAETRAEFAERSV
AKLEKTIDDLEDKLKCTKEEHLCTQRMLDQTLLDLNEM

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_705935
RefSeq Size 3212
RefSeq ORF 744
Synonyms CAPM1; CFTD; HEL-189; HEL-S-82p; hscp30; NEM1; OK/SW-cl.5; TM-5; TM3; TM5; TM30; TM30nm; TPM3nu; TPMsk3; TRK
Locus ID 7170
UniProt ID P06753
Cytogenetics 1q21.3
Summary This gene encodes a member of the tropomyosin family of actin-binding proteins. Tropomyosins are dimers of coiled-coil proteins that provide stability to actin filaments and regulate access of other actin-binding proteins. Mutations in this gene result in autosomal dominant nemaline myopathy and other muscle disorders. This locus is involved in translocations with other loci, including anaplastic lymphoma receptor tyrosine kinase (ALK) and neurotrophic tyrosine kinase receptor type 1 (NTRK1), which result in the formation of fusion proteins that act as oncogenes. There are numerous pseudogenes for this gene on different chromosomes. Alternative splicing results in multiple transcript variants. provided by RefSeq, May 2013
Protein Pathways Cardiac muscle contraction, Dilated cardiomyopathy, Hypertrophic cardiomyopathy (HCM), Pathways in cancer, Thyroid cancer
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Tropomyosin 3" proteins (16)
SKU Description Size Price
PH303276 TPM3 MS Standard C13 and N15-labeled recombinant protein (NP_689476) 10 ug
$3,360.00
PH316840 TPM3 MS Standard C13 and N15-labeled recombinant protein (NP_001036816) 10 ug
$3,360.00
PH320212 TPM3 MS Standard C13 and N15-labeled recombinant protein (NP_001036818) 10 ug
$3,360.00
LC407004 Lyophilized TPM3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC407686 Lyophilized TPM3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420816 Lyophilized TPM3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420818 Lyophilized TPM3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY407004 Transient overexpression lysate of tropomyosin 3 (TPM3), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY407686 Transient overexpression lysate of tropomyosin 3 (TPM3), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY420816 Transient overexpression lysate of tropomyosin 3 (TPM3), transcript variant 4 (as WB positive control) 100 ug
$436.00
LY420818 Transient overexpression lysate of tropomyosin 3 (TPM3), transcript variant 5 (as WB positive control) 100 ug
$436.00
TP303276 Recombinant protein of human tropomyosin 3 (TPM3), transcript variant 1, 20 µg 20 ug
$867.00
TP309904 Recombinant protein of human tropomyosin 3 (TPM3), transcript variant 2, 20 µg 20 ug
$867.00
TP316840 Recombinant protein of human tropomyosin 3 (TPM3), transcript variant 4, 20 µg 20 ug
$867.00
TP320212 Purified recombinant protein of Homo sapiens tropomyosin 3 (TPM3), transcript variant 5, 20 µg 20 ug
$867.00
TP720883 Purified recombinant protein of Human tropomyosin 3 (TPM3), transcript variant 1 10 ug
$275.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products