OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PSMD14 (NM_005805) Human Mass Spec Standard

Be the first to review this product
SKU
PH309829
PSMD14 MS Standard C13 and N15-labeled recombinant protein (NP_005796)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA321727 Anti-PSMD14 Rabbit Polyclonal Antibody
100 ul
$305.00
LY401764 Transient overexpression lysate of proteasome (prosome, macropain) 26S subunit, non-ATPase, 14 (PSMD14) (as WB positive control) 100 ug
$436.00

Other products for "PSMD14 or NM_005805"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC209829
Predicted MW 34.6 kDa
Protein Sequence
Protein Sequence
>RC209829 protein sequence
Red=Cloning site Green=Tags(s)

MDRLLRLGGGMPGLGQGPPTDAPAVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVRVI
DVFAMPQSGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEALSERA
VAVVVDPIQSVKGKVVIDAFRLINANMMVLGHEPRQTTSNLGHLNKPSIQALIHGLNRHYYSITINYRKN
ELEQKMLLNLHKKSWMEGLTLQDYSEHCKHNESVVKEMLELAKNYNKAVEEEDKMTPEQLAIKNVGKQDP
KRHLEEHVDVLMTSNIVQCLAAMLDTVVFK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005796
RefSeq Size 1734
RefSeq ORF 930
Synonyms PAD1; POH1; RPN11
Locus ID 10213
UniProt ID O00487
Cytogenetics 2q24.2
Summary This gene encodes a component of the 26S proteasome. The 26S proteasome is a large multiprotein complex that catalyzes the degradation of ubiquitinated intracellular proteins. The encoded protein is a component of the 19S regulatory cap complex of the 26S proteasome and mediates substrate deubiquitination. A pseudogene of this gene is also located on the long arm of chromosome 2. provided by RefSeq, Feb 2012
Protein Families Druggable Genome, Protease
Protein Pathways Proteasome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PSMD14" proteins (3)
SKU Description Size Price
LC401764 Lyophilized PSMD14 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401764 Transient overexpression lysate of proteasome (prosome, macropain) 26S subunit, non-ATPase, 14 (PSMD14) (as WB positive control) 100 ug
$436.00
TP309829 Recombinant protein of human proteasome (prosome, macropain) 26S subunit, non-ATPase, 14 (PSMD14), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products