OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

HDDC2 (NM_016063) Human Mass Spec Standard

Be the first to review this product
SKU
PH309808
HDDC2 MS Standard C13 and N15-labeled recombinant protein (NP_057147)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA344256 Rabbit Polyclonal Anti-HDDC2 Antibody - N-terminal region
100 ul
$585.00
LY414212 Transient overexpression lysate of HD domain containing 2 (HDDC2) (as WB positive control) 100 ug
$436.00

Other products for "HDDC2 or NM_016063"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC209808
Predicted MW 23.4 kDa
Protein Sequence
Protein Sequence
>RC209808 protein sequence
Red=Cloning site Green=Tags(s)

MASVSSATFSGHGARSLLQFLRLVGQLKRVPRTGWVYRNVQRPESVSDHMYRMAVMAMVIKDDRLNKDRC
VRLALVHDMAECIVGDIAPADNIPKEEKHRREEEAMKQITQLLPEDLRKELYELWEEYETRSSAEAKFVK
QLDQCEMILQASEYEDLEHKPGRLQDFYDSTAGKFNHPEIVQLVSELEAERSTNIAAAASEPHS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057147
RefSeq Size 1615
RefSeq ORF 612
Synonyms C6orf74; CGI-130; dJ167O5.2; NS5ATP2
Locus ID 51020
UniProt ID Q7Z4H3
Cytogenetics 6q22.31
Summary Catalyzes the dephosphorylation of the nucleoside 5'-monophosphates deoxyadenosine monophosphate (dAMP), deoxycytidine monophosphate (dCMP), deoxyguanosine monophosphate (dGMP) and deoxythymidine monophosphate (dTMP).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "HDDC2" proteins (3)
SKU Description Size Price
LC414212 Lyophilized HDDC2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY414212 Transient overexpression lysate of HD domain containing 2 (HDDC2) (as WB positive control) 100 ug
$436.00
TP309808 Recombinant protein of human HD domain containing 2 (HDDC2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products