OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

OTUB2 (NM_023112) Human Mass Spec Standard

Be the first to review this product
SKU
PH309650
OTUB2 MS Standard C13 and N15-labeled recombinant protein (NP_075601)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA501946 OTUB2 mouse monoclonal antibody, clone OTI11B3 (formerly 11B3) 100 ul
$447.00
LY402958 Transient overexpression lysate of OTU domain, ubiquitin aldehyde binding 2 (OTUB2) (as WB positive control) 100 ug
$436.00

Other products for "OTUB2 or NM_023112"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC209650
Predicted MW 27.2 kDa
Protein Sequence
Protein Sequence
>RC209650 protein sequence
Red=Cloning site Green=Tags(s)

MSETSFNLISEKCDILSILRDHPENRIYRRKIEELSKRFTAIRKTKGDGNCFYRALGYSYLESLLGKSRE
IFKFKERVLQTPNDLLAAGFEEHKFRNFFNAFYSVVELVEKDGSVSSLLKVFNDQSASDHIVQFLRLLTS
AFIRNRADFFRHFIDEEMDIKDFCTHEVEPMATECDHIQITALSQALSIALQVEYVDEMDTALNHHVFPE
AATPSVYLLYKTSHYNILYAADKH

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_075601
RefSeq Size 3873
RefSeq ORF 702
Synonyms C14orf137; OTB2; OTU2
Locus ID 78990
UniProt ID Q96DC9
Cytogenetics 14q32.12
Summary This gene encodes one of several deubiquitylating enzymes. Ubiquitin modification of proteins is needed for their stability and function; to reverse the process, deubiquityling enzymes remove ubiquitin. This protein contains an OTU domain and binds Ubal (ubiquitin aldehyde); an active cysteine protease site is present in the OTU domain. provided by RefSeq, Aug 2011
Protein Families Protease
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "OTUB2" proteins (4)
SKU Description Size Price
LC402958 Lyophilized OTUB2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402958 Transient overexpression lysate of OTU domain, ubiquitin aldehyde binding 2 (OTUB2) (as WB positive control) 100 ug
$436.00
TP309650 Recombinant protein of human OTU domain, ubiquitin aldehyde binding 2 (OTUB2), 20 µg 20 ug
$867.00
TP720215 Recombinant protein of human OTU domain, ubiquitin aldehyde binding 2 (OTUB2) 10 ug
$340.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products