OTUB2 (NM_023112) Human Tagged ORF Clone

SKU
RC209650
OTUB2 (Myc-DDK-tagged)-Human OTU domain, ubiquitin aldehyde binding 2 (OTUB2)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol OTUB2
Synonyms C14orf137; OTB2; OTU2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC209650 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGTGAAACATCTTTCAACCTAATATCAGAAAAATGTGACATTCTATCCATTCTTCGGGACCATCCTG
AAAACAGGATTTACCGGAGGAAAATCGAGGAACTCAGCAAAAGGTTCACCGCCATCCGCAAGACCAAAGG
GGATGGGAACTGCTTCTACAGGGCCTTGGGCTATTCCTACCTGGAGTCCCTGCTGGGGAAGAGCAGGGAG
ATCTTCAAGTTCAAAGAACGCGTACTGCAGACCCCAAATGACCTTCTGGCTGCTGGCTTTGAGGAGCACA
AGTTCAGAAACTTCTTCAATGCTTTTTACAGTGTGGTGGAACTGGTAGAGAAGGACGGCTCAGTGTCCAG
CCTGCTGAAGGTGTTCAACGACCAGAGTGCCTCGGACCACATCGTGCAGTTCCTGCGCCTGCTCACGTCG
GCCTTCATCAGGAACCGAGCAGACTTCTTCCGGCACTTCATTGATGAGGAGATGGACATCAAAGACTTCT
GCACTCACGAAGTAGAGCCCATGGCCACGGAGTGTGACCACATCCAGATCACGGCGTTGTCGCAGGCCCT
GAGCATTGCCCTGCAAGTGGAGTACGTGGACGAGATGGATACCGCCCTGAACCACCACGTGTTCCCTGAG
GCCGCCACCCCTTCCGTTTACCTGCTCTATAAAACATCCCACTACAACATCCTTTATGCAGCCGATAAAC
AT


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC209650 protein sequence
Red=Cloning site Green=Tags(s)

MSETSFNLISEKCDILSILRDHPENRIYRRKIEELSKRFTAIRKTKGDGNCFYRALGYSYLESLLGKSRE
IFKFKERVLQTPNDLLAAGFEEHKFRNFFNAFYSVVELVEKDGSVSSLLKVFNDQSASDHIVQFLRLLTS
AFIRNRADFFRHFIDEEMDIKDFCTHEVEPMATECDHIQITALSQALSIALQVEYVDEMDTALNHHVFPE
AATPSVYLLYKTSHYNILYAADKH

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-RsrII Cloning Scheme for this gene Plasmid Map
ACCN NM_023112
ORF Size 702 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_023112.1
RefSeq Size 3873 bp
RefSeq ORF 705 bp
Locus ID 78990
UniProt ID Q96DC9
Cytogenetics 14q32.12
Protein Families Protease
MW 27.2 kDa
Summary This gene encodes one of several deubiquitylating enzymes. Ubiquitin modification of proteins is needed for their stability and function; to reverse the process, deubiquityling enzymes remove ubiquitin. This protein contains an OTU domain and binds Ubal (ubiquitin aldehyde); an active cysteine protease site is present in the OTU domain. [provided by RefSeq, Aug 2011]
Write Your Own Review
You're reviewing:OTUB2 (NM_023112) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC209650L1 Lenti ORF clone of Human OTU domain, ubiquitin aldehyde binding 2 (OTUB2), Myc-DDK-tagged 10 ug
$600.00
RC209650L2 Lenti ORF clone of Human OTU domain, ubiquitin aldehyde binding 2 (OTUB2), mGFP tagged 10 ug
$600.00
RC209650L3 Lenti ORF clone of Human OTU domain, ubiquitin aldehyde binding 2 (OTUB2), Myc-DDK-tagged 10 ug
$600.00
RC209650L4 Lenti ORF clone of Human OTU domain, ubiquitin aldehyde binding 2 (OTUB2), mGFP tagged 10 ug
$600.00
RG209650 OTUB2 (tGFP-tagged) - Human OTU domain, ubiquitin aldehyde binding 2 (OTUB2) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC123904 OTUB2 (untagged)-Human OTU domain, ubiquitin aldehyde binding 2 (OTUB2) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.