OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RD3 (NM_183059) Human Mass Spec Standard

Be the first to review this product
SKU
PH309596
RD3 MS Standard C13 and N15-labeled recombinant protein (NP_898882)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA333379 Rabbit Polyclonal Anti-RD3 Antibody
100 ul
$585.00
LY405222 Transient overexpression lysate of retinal degeneration 3 (RD3), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "RD3 or NM_183059"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC209596
Predicted MW 22.7 kDa
Protein Sequence
Protein Sequence
>RC209596 protein sequence
Red=Cloning site Green=Tags(s)

MSLISWLRWNEAPSRLSTRSPAEMVLETLMMELTGQMREAERQQRERSNAVRKVCTGVDYSWLASTPRST
YDLSPIERLQLEDVCVKIHPSYCGPAILRFRQLLAEQEPEVQEVSQLFRSVLQEVLERMKQEEEAHKLTR
QWSLRPRGSLATFKTRARISPFASDIRTISEDVERDTPPPLRSWSMPEFRAPKAD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_898882
RefSeq Size 4290
RefSeq ORF 585
Synonyms C1orf36; LCA12
Locus ID 343035
UniProt ID Q7Z3Z2
Cytogenetics 1q32.3
Summary This gene encodes a retinal protein that is associated with promyelocytic leukemia-gene product (PML) bodies in the nucleus. Mutations in this gene cause Leber congenital amaurosis type 12, a disease that results in retinal degeneration. Alternative splicing results in multiple transcript variants. provided by RefSeq, Sep 2009
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RD3" proteins (5)
SKU Description Size Price
LC405222 Lyophilized RD3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC431781 Lyophilized RD3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY405222 Transient overexpression lysate of retinal degeneration 3 (RD3), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY431781 Transient overexpression lysate of retinal degeneration 3 (RD3), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP309596 Recombinant protein of human retinal degeneration 3 (RD3), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products