RD3 (NM_183059) Human Recombinant Protein

SKU
TP309596
Recombinant protein of human retinal degeneration 3 (RD3), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC209596 protein sequence
Red=Cloning site Green=Tags(s)

MSLISWLRWNEAPSRLSTRSPAEMVLETLMMELTGQMREAERQQRERSNAVRKVCTGVDYSWLASTPRST
YDLSPIERLQLEDVCVKIHPSYCGPAILRFRQLLAEQEPEVQEVSQLFRSVLQEVLERMKQEEEAHKLTR
QWSLRPRGSLATFKTRARISPFASDIRTISEDVERDTPPPLRSWSMPEFRAPKAD

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 22.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_898882
Locus ID 343035
UniProt ID Q7Z3Z2
Cytogenetics 1q32.3
RefSeq Size 4290
RefSeq ORF 585
Synonyms C1orf36; LCA12
Summary This gene encodes a retinal protein that is associated with promyelocytic leukemia-gene product (PML) bodies in the nucleus. Mutations in this gene cause Leber congenital amaurosis type 12, a disease that results in retinal degeneration. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2009]
Write Your Own Review
You're reviewing:RD3 (NM_183059) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH309596 RD3 MS Standard C13 and N15-labeled recombinant protein (NP_898882) 10 ug
$3,255.00
LC405222 RD3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431781 RD3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY405222 Transient overexpression lysate of retinal degeneration 3 (RD3), transcript variant 1 100 ug
$436.00
LY431781 Transient overexpression lysate of retinal degeneration 3 (RD3), transcript variant 2 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.