RD3 (NM_183059) Human Mass Spec Standard

SKU
PH309596
RD3 MS Standard C13 and N15-labeled recombinant protein (NP_898882)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC209596]
Predicted MW 22.7 kDa
Protein Sequence
Protein Sequence
>RC209596 protein sequence
Red=Cloning site Green=Tags(s)

MSLISWLRWNEAPSRLSTRSPAEMVLETLMMELTGQMREAERQQRERSNAVRKVCTGVDYSWLASTPRST
YDLSPIERLQLEDVCVKIHPSYCGPAILRFRQLLAEQEPEVQEVSQLFRSVLQEVLERMKQEEEAHKLTR
QWSLRPRGSLATFKTRARISPFASDIRTISEDVERDTPPPLRSWSMPEFRAPKAD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_898882
RefSeq Size 4290
RefSeq ORF 585
Synonyms C1orf36; LCA12
Locus ID 343035
UniProt ID Q7Z3Z2
Cytogenetics 1q32.3
Summary This gene encodes a retinal protein that is associated with promyelocytic leukemia-gene product (PML) bodies in the nucleus. Mutations in this gene cause Leber congenital amaurosis type 12, a disease that results in retinal degeneration. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2009]
Write Your Own Review
You're reviewing:RD3 (NM_183059) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC405222 RD3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431781 RD3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY405222 Transient overexpression lysate of retinal degeneration 3 (RD3), transcript variant 1 100 ug
$436.00
LY431781 Transient overexpression lysate of retinal degeneration 3 (RD3), transcript variant 2 100 ug
$436.00
TP309596 Recombinant protein of human retinal degeneration 3 (RD3), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.