OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ZNF784 (NM_203374) Human Mass Spec Standard

Be the first to review this product
SKU
PH309589
ZNF784 MS Standard C13 and N15-labeled recombinant protein (NP_976308)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA339844 Rabbit Polyclonal Anti-ZNF784 Antibody
100 ul
$585.00
LY404316 Transient overexpression lysate of zinc finger protein 784 (ZNF784) (as WB positive control) 100 ug
$436.00

Other products for "ZNF784 or NM_203374"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC209589
Predicted MW 34.2 kDa
Protein Sequence
Protein Sequence
>RC209589 protein sequence
Red=Cloning site Green=Tags(s)

MAAARPEAQSRSSPTPESRSQEPLDLVLVPDDCRPGTPPSDLIEIQVVKVTDTTLVPEPPEPGSFHCALC
PAAFRLVSELLFHEHGHLAGAEGGGQGGDPSRCHVCGHSCPGPASLRAHYSLHTGERPYRCALCPRAFKA
LAPLLRHQHRHGVEPGTSRRPPDTAAVAEQRPGVAPERAEVVMAAAAAGAAVGKPFACRFCAKPFRRSSD
MRDHERVHTGERPYHCGICGKGFTQSSVLSGHARIHTGERPFRCTLCDRTFNNSSNFRKHQRTHFHGPGP
GLGDSGGQLGSSAAEGSGSGCGVGDPAEEGRGETAKVKVEADQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_976308
RefSeq Size 2006
RefSeq ORF 969
Locus ID 147808
UniProt ID Q8NCA9
Cytogenetics 19q13.42
Summary May be involved in transcriptional regulation.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ZNF784" proteins (3)
SKU Description Size Price
LC404316 Lyophilized ZNF784 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY404316 Transient overexpression lysate of zinc finger protein 784 (ZNF784) (as WB positive control) 100 ug
$436.00
TP309589 Recombinant protein of human zinc finger protein 784 (ZNF784), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products