OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

USP3 (NM_006537) Human Mass Spec Standard

Be the first to review this product
SKU
PH309550
USP3 MS Standard C13 and N15-labeled recombinant protein (NP_006528)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA369800 USP3 rabbit polyclonal antibody
100 ul
$310.00
LY416579 Transient overexpression lysate of ubiquitin specific peptidase 3 (USP3) (as WB positive control) 100 ug
$436.00

Other products for "USP3 or NM_006537"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC209550
Predicted MW 59.3 kDa
Protein Sequence
Protein Sequence
>RC209550 representing NM_006537
Red=Cloning site Green=Tags(s)

MECPHLSSSVCIAPDSAKFPNGSPSSWCCSVCRSNKSPWVCLTCSSVHCGRYVNGHAKKHYEDAQVPLTN
HKKSEKQDKVQHTVCMDCSSYSTYCYRCDDFVVNDTKLGLVQKVREHLQNLENSAFTADRHKKRKLLENS
TLNSKLLKVNGSTTAICATGLRNLGNTCFMNAILQSLSNIEQFCCYFKELPAVELRNGKTAGRRTYHTRS
QGDNNVSLVEEFRKTLCALWQGSQTAFSPESLFYVVWKIMPNFRGYQQQDAHEFMRYLLDHLHLELQGGF
NGVSRSAILQENSTLSASNKCCINGASTVVTAIFGGILQNEVNCLICGTESRKFDPFLDLSLDIPSQFRS
KRSKNQENGPVCSLRDCLRSFTDLEELDETELYMCHKCKKKQKSTKKFWIQKLPKVLCLHLKRFHWTAYL
RNKVDTYVEFPLRGLDMKCYLLEPENSGPESCLYDLAAVVVHHGSGVGSGHYTAYATHEGRWFHFNDSTV
TLTDEETVVKAKAYILFYVEHQAKAGSDKL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006528
RefSeq Size 5606
RefSeq ORF 1560
Synonyms SIH003; UBP
Locus ID 9960
UniProt ID Q9Y6I4
Cytogenetics 15q22.31
Summary Hydrolase that deubiquitinates monoubiquitinated target proteins such as histone H2A and H2B. Required for proper progression through S phase and subsequent mitotic entry. May regulate the DNA damage response (DDR) checkpoint through deubiquitination of H2A at DNA damage sites. Associates with the chromatin.UniProtKB/Swiss-Prot Function
Protein Families Druggable Genome, Protease
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "USP3" proteins (3)
SKU Description Size Price
LC416579 Lyophilized USP3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY416579 Transient overexpression lysate of ubiquitin specific peptidase 3 (USP3) (as WB positive control) 100 ug
$436.00
TP309550 Recombinant protein of human ubiquitin specific peptidase 3 (USP3), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products