OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Lactate Dehydrogenase C (LDHC) (NM_002301) Human Mass Spec Standard

Be the first to review this product
SKU
PH309516
LDHC MS Standard C13 and N15-labeled recombinant protein (NP_002292)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA364872 LDHC rabbit polyclonal antibody
100 ul
$310.00
LY400837 Transient overexpression lysate of lactate dehydrogenase C (LDHC), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "Lactate Dehydrogenase C or NM_002301"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC209516
Predicted MW 36.1 kDa
Protein Sequence
Protein Sequence
>RC209516 representing NM_002301
Red=Cloning site Green=Tags(s)

MSTVKEQLIEKLIEDDENSQCKITIVGTGAVGMACAISILLKDLADELALVDVALDKLKGEMMDLQHGSL
FFSTSKITSGKDYSVSANSRIVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVSNPV
DILTYIVWKISGLPVTRVIGSGCNLDSARFRYLIGEKLGVHPTSCHGWIIGEHGDSSVPLWSGVNVAGVA
LKTLDPKLGTDSDKEHWKNIHKQVIQSAYEIIKLKGYTSWAIGLSVMDLVGSILKNLRRVHPVSTMVKGL
YGIKEELFLSIPCVLGRNGVSDVVKINLNSEEEALFKKSAETLWNIQKDLIF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002292
RefSeq Size 1278
RefSeq ORF 996
Synonyms CT32; LDH3; LDHX
Locus ID 3948
UniProt ID P07864
Cytogenetics 11p15.1
Summary Lactate dehydrogenase C catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. LDHC is testis-specific and belongs to the lactate dehydrogenase family. Two transcript variants have been detected which differ in the 5' untranslated region. provided by RefSeq, Jul 2008
Protein Pathways Cysteine and methionine metabolism, Glycolysis / Gluconeogenesis, Metabolic pathways, Propanoate metabolism, Pyruvate metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Lactate Dehydrogenase C" proteins (7)
SKU Description Size Price
PH310627 LDHC MS Standard C13 and N15-labeled recombinant protein (NP_059144) 10 ug
$3,360.00
LC400837 Lyophilized LDHC HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC413747 Lyophilized LDHC HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400837 Transient overexpression lysate of lactate dehydrogenase C (LDHC), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY413747 Transient overexpression lysate of lactate dehydrogenase C (LDHC), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP309516 Recombinant protein of human lactate dehydrogenase C (LDHC), transcript variant 1, 20 µg 20 ug
$867.00
TP310627 Recombinant protein of human lactate dehydrogenase C (LDHC), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products