Lactate Dehydrogenase C (LDHC) (NM_017448) Human Mass Spec Standard

SKU
PH310627
LDHC MS Standard C13 and N15-labeled recombinant protein (NP_059144)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC210627]
Predicted MW 36.3 kDa
Protein Sequence
Protein Sequence
>RC210627 protein sequence
Red=Cloning site Green=Tags(s)

MSTVKEQLIEKLIEDDENSQCKITIVGTGAVGMACAISILLKDLADELALVDVALDKLKGEMMDLQHGSL
FFSTSKITSGKDYSVSANSRIVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVSNPV
DILTYIVWKISGLPVTRVIGSGCNLDSARFRYLIGEKLGVHPTSCHGWIIGEHGDSSVPLWSGVNVAGVA
LKTLDPKLGTDSDKEHWKNIHKQVIQSAYEIIKLKGYTSWAIGLSVMDLVGSILKNLRRVHPVSTMVKGL
YGIKEELFLSIPCVLGRNGVSDVVKINLNSEEEALFKKSAETLWNIQKDLIF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_059144
RefSeq Size 1264
RefSeq ORF 996
Synonyms CT32; LDH3; LDHX
Locus ID 3948
UniProt ID P07864
Cytogenetics 11p15.1
Summary Lactate dehydrogenase C catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. LDHC is testis-specific and belongs to the lactate dehydrogenase family. Two transcript variants have been detected which differ in the 5' untranslated region. [provided by RefSeq, Jul 2008]
Protein Pathways Cysteine and methionine metabolism, Glycolysis / Gluconeogenesis, Metabolic pathways, Propanoate metabolism, Pyruvate metabolism
Write Your Own Review
You're reviewing:Lactate Dehydrogenase C (LDHC) (NM_017448) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH309516 LDHC MS Standard C13 and N15-labeled recombinant protein (NP_002292) 10 ug
$3,255.00
LC400837 LDHC HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC413747 LDHC HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400837 Transient overexpression lysate of lactate dehydrogenase C (LDHC), transcript variant 1 100 ug
$436.00
LY413747 Transient overexpression lysate of lactate dehydrogenase C (LDHC), transcript variant 2 100 ug
$436.00
TP309516 Recombinant protein of human lactate dehydrogenase C (LDHC), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP310627 Recombinant protein of human lactate dehydrogenase C (LDHC), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.