Lactate Dehydrogenase C (LDHC) (NM_002301) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC209516] |
Predicted MW | 36.1 kDa |
Protein Sequence |
Protein Sequence
>RC209516 representing NM_002301
Red=Cloning site Green=Tags(s) MSTVKEQLIEKLIEDDENSQCKITIVGTGAVGMACAISILLKDLADELALVDVALDKLKGEMMDLQHGSL FFSTSKITSGKDYSVSANSRIVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVSNPV DILTYIVWKISGLPVTRVIGSGCNLDSARFRYLIGEKLGVHPTSCHGWIIGEHGDSSVPLWSGVNVAGVA LKTLDPKLGTDSDKEHWKNIHKQVIQSAYEIIKLKGYTSWAIGLSVMDLVGSILKNLRRVHPVSTMVKGL YGIKEELFLSIPCVLGRNGVSDVVKINLNSEEEALFKKSAETLWNIQKDLIF myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_002292 |
RefSeq Size | 1278 |
RefSeq ORF | 996 |
Synonyms | CT32; LDH3; LDHX |
Locus ID | 3948 |
UniProt ID | P07864 |
Cytogenetics | 11p15.1 |
Summary | Lactate dehydrogenase C catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. LDHC is testis-specific and belongs to the lactate dehydrogenase family. Two transcript variants have been detected which differ in the 5' untranslated region. [provided by RefSeq, Jul 2008] |
Protein Pathways | Cysteine and methionine metabolism, Glycolysis / Gluconeogenesis, Metabolic pathways, Propanoate metabolism, Pyruvate metabolism |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH310627 | LDHC MS Standard C13 and N15-labeled recombinant protein (NP_059144) | 10 ug |
$3,255.00
|
|
LC400837 | LDHC HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC413747 | LDHC HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY400837 | Transient overexpression lysate of lactate dehydrogenase C (LDHC), transcript variant 1 | 100 ug |
$436.00
|
|
LY413747 | Transient overexpression lysate of lactate dehydrogenase C (LDHC), transcript variant 2 | 100 ug |
$436.00
|
|
TP309516 | Recombinant protein of human lactate dehydrogenase C (LDHC), transcript variant 1, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP310627 | Recombinant protein of human lactate dehydrogenase C (LDHC), transcript variant 2, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.