OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

THOC7 (NM_025075) Human Mass Spec Standard

Be the first to review this product
SKU
PH309500
THOC7 MS Standard C13 and N15-labeled recombinant protein (NP_079351)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA368976 THOC7 rabbit polyclonal antibody
100 ul
$310.00
LY410901 Transient overexpression lysate of THO complex 7 homolog (Drosophila) (THOC7) (as WB positive control) 100 ug
$436.00

Other products for "THOC7 or NM_025075"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC209500
Predicted MW 23.7 kDa
Protein Sequence
Protein Sequence
>RC209500 protein sequence
Red=Cloning site Green=Tags(s)

MGAVTDDEVIRKRLLIDGDGAGDDRRINLLVKSFIKWCNSGSQEEGYSQYQRMLSTLSQCEFSMGKTLLV
YDMNLREMENYEKIYKEIECSIAGAHEKIAECKKQILQAKRIRKNRQEYDALAKVIQHHPDRHETLKELE
ALGKELEHLSHIKESVEDKLELRRKQFHVLLSTIHELQQTLENDEKLSEVEEAQEASMETDPKP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_079351
RefSeq Size 1027
RefSeq ORF 612
Synonyms fSAP24; hTREX30; NIF3L1BP1
Locus ID 80145
UniProt ID Q6I9Y2
Cytogenetics 3p14.1
Summary Required for efficient export of polyadenylated RNA. Acts as component of the THO subcomplex of the TREX complex which is thought to couple mRNA transcription, processing and nuclear export, and which specifically associates with spliced mRNA and not with unspliced pre-mRNA. TREX is recruited to spliced mRNAs by a transcription-independent mechanism, binds to mRNA upstream of the exon-junction complex (EJC) and is recruited in a splicing- and cap-dependent manner to a region near the 5' end of the mRNA where it functions in mRNA export to the cytoplasm via the TAP/NFX1 pathway.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "THOC7" proteins (3)
SKU Description Size Price
LC410901 Lyophilized THOC7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY410901 Transient overexpression lysate of THO complex 7 homolog (Drosophila) (THOC7) (as WB positive control) 100 ug
$436.00
TP309500 Recombinant protein of human THO complex 7 homolog (Drosophila) (THOC7), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products