OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ARL8B (NM_018184) Human Mass Spec Standard

Be the first to review this product
SKU
PH309368
ARL8B MS Standard C13 and N15-labeled recombinant protein (NP_060654)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA373686 ARL8B Rabbit polyclonal Antibody
100 ul
$410.00
LY402654 Transient overexpression lysate of ADP-ribosylation factor-like 8B (ARL8B) (as WB positive control) 100 ug
$436.00

Other products for "ARL8B or NM_018184"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC209368
Predicted MW 21.5 kDa
Protein Sequence
Protein Sequence
>RC209368 protein sequence
Red=Cloning site Green=Tags(s)

MLALISRLLDWFRSLFWKEEMELTLVGLQYSGKTTFVNVIASGQFSEDMIPTVGFNMRKVTKGNVTIKIW
DIGGQPRFRSMWERYCRGVNAIVYMIDAADREKIEASRNELHNLLDKPQLQGIPVLVLGNKRDLPNALDE
KQLIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSKSRRS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060654
RefSeq Size 3008
RefSeq ORF 558
Synonyms ARL10C; Gie1
Locus ID 55207
UniProt ID Q9NVJ2
Cytogenetics 3p26.1
Summary Plays a role in lysosome motility (PubMed:16537643, PubMed:25898167). In neurons, mediates the anterograde axonal long-range transport of presynaptic lysosome-related vesicles required for presynaptic biogenesis and synaptic function (By similarity). May play a role in chromosome segregation (PubMed:15331635).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ARL8B" proteins (3)
SKU Description Size Price
LC402654 Lyophilized ARL8B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402654 Transient overexpression lysate of ADP-ribosylation factor-like 8B (ARL8B) (as WB positive control) 100 ug
$436.00
TP309368 Recombinant protein of human ADP-ribosylation factor-like 8B (ARL8B), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products