ARL8B (NM_018184) Human Recombinant Protein

SKU TP309368

Recombinant protein of human ADP-ribosylation factor-like 8B (ARL8B), 20 µg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC209368 protein sequence; Red=Cloning site Green=Tags(s); ; MLALISRLLDWFRSLFWKEEMELTLVGLQYSGKTTFVNVIASGQFSEDMIPTVGFNMRKVTKGNVTIKIW; DIGGQPRFRSMWERYCRGVNAIVYMIDAADREKIEASRNELHNLLDKPQLQGIPVLVLGNKRDLPNALDE; KQLIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSKSRRS; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 21.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_060654
• Locus ID: 55207
• UniProt ID: Q9NVJ2
• Cytogenetics: 3p26.1
• RefSeq Size: 3008
• RefSeq ORF: 558
• Synonyms: ARL10C; Gie1
• Summary: Plays a role in lysosome motility (PubMed:16537643, PubMed:25898167). In neurons, mediates the anterograde axonal long-range transport of presynaptic lysosome-related vesicles required for presynaptic biogenesis and synaptic function (By similarity). May play a role in chromosome segregation (PubMed:15331635).[UniProtKB/Swiss-Prot Function]