OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

LACRT (NM_033277) Human Mass Spec Standard

Be the first to review this product
SKU
PH309355
LACRT MS Standard C13 and N15-labeled recombinant protein (NP_150593)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY409624 Transient overexpression lysate of lacritin (LACRT) (as WB positive control) 100 ug
$436.00

Other products for "LACRT or NM_033277"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC209355
Predicted MW 14.2 kDa
Protein Sequence
Protein Sequence
>RC209355 protein sequence
Red=Cloning site Green=Tags(s)

MKFTTLLFLAAVAGALVYAEDASSDSTGADPAQEAGTSKPNEEISGPAEPASPPETTTTAQETSAAAVQG
TAKVTSSRQELNPLKSIVEKSILLTEQALAKAGKGMHGGVPGGKQFIENGSEFAQKLLKKFSLLKPWA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_150593
RefSeq Size 508
RefSeq ORF 414
Locus ID 90070
UniProt ID Q9GZZ8
Cytogenetics 12q13.2
Summary The protein encoded by this gene is highly expressed in the lacrimal glands and localized primarily to secretory granules and secretory fluid. It augments lacrimal acinar cell secretion, promotes ductal cell proliferation, and stimulates signaling through tyrosine phosphorylation and release of calcium. provided by RefSeq, Jul 2008
Protein Families Secreted Protein
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "LACRT" proteins (3)
SKU Description Size Price
LC409624 Lyophilized LACRT HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY409624 Transient overexpression lysate of lacritin (LACRT) (as WB positive control) 100 ug
$436.00
TP309355 Recombinant protein of human lacritin (LACRT), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products