OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

JPT2 (NM_144570) Human Mass Spec Standard

Be the first to review this product
SKU
PH309294
HN1L MS Standard C13 and N15-labeled recombinant protein (NP_653171)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA370313 JPT2 rabbit polyclonal antibody
100 ul
$310.00
LY408279 Transient overexpression lysate of hematological and neurological expressed 1-like (HN1L) (as WB positive control) 100 ug
$436.00

Other products for "JPT2 or NM_144570"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC209294
Predicted MW 20.1 kDa
Protein Sequence
Protein Sequence
>RC209294 protein sequence
Red=Cloning site Green=Tags(s)

MFQVPDSEGGRAGSRAMKPPGGESSNLFGSPEEATPSSRPNRMASNIFGPTEEPQNIPKRTNPPGGKGSG
IFDESTPVQTRQHLNPPGGKTSDIFGSPVTATSRLAHPNKPKDHVFLCEGEEPKSDLKAARSIPAGAEPG
EKGSARKAGPAKEQEPMPTVDSHEPRLGPRPRSHNKVLNPPGGKSSISFY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_653171
RefSeq Size 3705
RefSeq ORF 570
Synonyms C16orf34; HN1L; L11
Locus ID 90861
UniProt ID Q9H910
Cytogenetics 16p13.3
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "JPT2" proteins (3)
SKU Description Size Price
LC408279 Lyophilized HN1L HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY408279 Transient overexpression lysate of hematological and neurological expressed 1-like (HN1L) (as WB positive control) 100 ug
$436.00
TP309294 Recombinant protein of human hematological and neurological expressed 1-like (HN1L), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products