OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DPH4 (DNAJC24) (NM_181706) Human Mass Spec Standard

Be the first to review this product
SKU
PH309088
DNAJC24 MS Standard C13 and N15-labeled recombinant protein (NP_859057)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA370945 DNAJC24 rabbit polyclonal antibody
100 ul
$310.00
LY405653 Transient overexpression lysate of DnaJ (Hsp40) homolog, subfamily C, member 24 (DNAJC24) (as WB positive control) 100 ug
$436.00

Other products for "DPH4 or NM_181706"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC209088
Predicted MW 17 kDa
Protein Sequence
Protein Sequence
>RC209088 protein sequence
Red=Cloning site Green=Tags(s)

MAVEQMPKKDWYSILGADPSANISDLKQKYQKLILMYHPDKQSTDVPAGTVEECVQKFIEIDQAWKILGN
EETKREYDLQRCEDDLRNVGPVDAQVYLEEMSWNEGDHSFYLSCRCGGKYSVSKDEAEEVSLISCDTCSL
IIELLHYN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_859057
RefSeq Size 3000
RefSeq ORF 444
Synonyms DPH4; JJJ3; ZCSL3
Locus ID 120526
UniProt ID Q6P3W2
Cytogenetics 11p13
Summary Diphthamide is a unique posttranslationally modified histidine found only in translation elongation factor-2 (EEF2; MIM 130610). This modification is conserved from archaebacteria to humans and serves as the target for ADP-ribosylation and inactivation of EEF2 by diphtheria toxin (DT) and Pseudomonas exotoxin A. DPH4 is 1 of several enzymes involved in synthesis of diphthamide in EEF2 (Liu et al., 2004 PubMed 15485916).supplied by OMIM, Mar 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "DPH4" proteins (3)
SKU Description Size Price
LC405653 Lyophilized DNAJC24 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY405653 Transient overexpression lysate of DnaJ (Hsp40) homolog, subfamily C, member 24 (DNAJC24) (as WB positive control) 100 ug
$436.00
TP309088 Recombinant protein of human DnaJ (Hsp40) homolog, subfamily C, member 24 (DNAJC24), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products