OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Chymotrypsin like protease (CTRL) (NM_001907) Human Mass Spec Standard

Be the first to review this product
SKU
PH309072
CTRL MS Standard C13 and N15-labeled recombinant protein (NP_001898)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY419665 Transient overexpression lysate of chymotrypsin-like (CTRL) (as WB positive control) 100 ug
$436.00

Other products for "Chymotrypsin like protease or NM_001907"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC209072
Predicted MW 28 kDa
Protein Sequence
Protein Sequence
>RC209072 protein sequence
Red=Cloning site Green=Tags(s)

MLLLSLTLSLVLLGSSWGCGIPAIKPALSFSQRIVNGENAVLGSWPWQVSLQDSSGFHFCGGSLISQSWV
VTAAHCNVSPGRHFVVLGEYDRSSNAEPLQVLSVSRAITHPSWNSTTMNNDVTLLKLASPAQYTTRISPV
CLASSNEALTEGLTCVTTGWGRLSGVGNVTPAHLQQVALPLVTVNQCRQYWGSSITDSMICAGGAGASSC
QGDSGGPLVCQKGNTWVLIGIVSWGTKNCNVRAPAVYTRVSKFSTWINQVIAYN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001898
RefSeq Size 1197
RefSeq ORF 792
Synonyms CTRL1
Locus ID 1506
UniProt ID P40313
Cytogenetics 16q22.1
Summary This gene encodes a serine-type endopeptidase with chymotrypsin- and elastase-2-like activities. The gene encoding this zymogen is expressed specifically in the pancreas and likely functions as a digestive enzyme. provided by RefSeq, Sep 2016
Protein Families Druggable Genome, Protease
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Chymotrypsin like protease" proteins (4)
SKU Description Size Price
LC419665 Lyophilized CTRL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY419665 Transient overexpression lysate of chymotrypsin-like (CTRL) (as WB positive control) 100 ug
$436.00
TP309072 Recombinant protein of human chymotrypsin-like (CTRL), 20 µg 20 ug
$867.00
TP720385 Recombinant protein of human chymotrypsin-like (CTRL) 10 ug
$275.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products