SUOX (NM_000456) Human Mass Spec Standard
CAT#: PH309066
SUOX MS Standard C13 and N15-labeled recombinant protein (NP_000447)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209066 |
Predicted MW | 60.3 kDa |
Protein Sequence |
>RC209066 protein sequence
Red=Cloning site Green=Tags(s) MLLLHRAVVLRLQQACRLKSIPSRICIQACSTNDSFQPQRPSLTFSGDNSSTQGWRVMGTLLGLGAVLAY QDHRCRAAQESTHIYTKEEVSSHTSPETGIWVTLGSEVFDVTEFVDLHPGGPSKLMLAAGGPLEPFWALY AVHNQSHVRELLAQYKIGELNPEDKVAPTVETSDPYADDPVRHPALKVNSQRPFNAEPPPELLTENYITP NPIFFTRNHLPVPNLDPDTYRLHVVGAPGGQSLSLSLDDLHNFPRYEITVTLQCAGNRRSEMTQVKEVKG LEWRTGAISTARWAGARLCDVLAQAGHQLCETEAHVCFEGLDSDPTGTAYGASIPLARAMDPEAEVLLAY EMNGQPLPRDHGFPVRVVVPGVVGARHVKWLGRVSVQPEESYSHWQRRDYKGFSPSVDWETVDFDSAPSI QELPVQSAITEPRDGETVESGEVTIKGYAWSGGGRAVIRVDVSLDGGLTWQVAKLDGEEQRPRKAWAWRL WQLKAPVPAGQKELNIVCKAVDDGYNVQPDTVAPIWNLRGVLSNAWHRVHVYVSP myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_000447 |
RefSeq Size | 2564 |
RefSeq ORF | 1635 |
Locus ID | 6821 |
UniProt ID | P51687, A0A024RB79 |
Cytogenetics | 12q13.2 |
Summary | Sulfite oxidase is a homodimeric protein localized to the intermembrane space of mitochondria. Each subunit contains a heme domain and a molybdopterin-binding domain. The enzyme catalyzes the oxidation of sulfite to sulfate, the final reaction in the oxidative degradation of the sulfur amino acids cysteine and methionine. Sulfite oxidase deficiency results in neurological abnormalities which are often fatal at an early age. Alternative splicing results in multiple transcript variants encoding identical proteins. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Sulfur metabolism |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC422321 | SUOX HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LC422322 | SUOX HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LC424706 | SUOX HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC425535 | SUOX HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY422321 | Transient overexpression lysate of sulfite oxidase (SUOX), nuclear gene encoding mitochondrial protein, transcript variant 2 |
USD 665.00 |
|
LY422322 | Transient overexpression lysate of sulfite oxidase (SUOX), nuclear gene encoding mitochondrial protein, transcript variant 3 |
USD 665.00 |
|
LY424706 | Transient overexpression lysate of sulfite oxidase (SUOX), nuclear gene encoding mitochondrial protein, transcript variant 1 |
USD 436.00 |
|
TP309066 | Recombinant protein of human sulfite oxidase (SUOX), nuclear gene encoding mitochondrial protein, transcript variant 1, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review