OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

THNSL2 (NM_018271) Human Mass Spec Standard

Be the first to review this product
SKU
PH309049
THNSL2 MS Standard C13 and N15-labeled recombinant protein (NP_060741)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA344888 Rabbit Polyclonal Anti-THNSL2 Antibody - middle region
100 ul
$585.00
LY413167 Transient overexpression lysate of threonine synthase-like 2 (S. cerevisiae) (THNSL2) (as WB positive control) 100 ug
$665.00

Other products for "THNSL2 or NM_018271"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC209049
Predicted MW 53.9 kDa
Protein Sequence
Protein Sequence
>RC209049 representing NM_018271
Red=Cloning site Green=Tags(s)

MWYVSTRGVAPRVNFEGALFSGYAPDGGLFMPEELPQLDRGTLCQWSTLSYPGLVKELCALFIGSELLPK
DELNDLIDRAFSRFRHREVVHLSRLRNGLNVLELWHGVTYAFKDLSLSCTTQFLQYFLEKREKHVTVVVG
TSGDTGSAAIESVQGAKNMDIIVLLPKGHCTKIQELQMTTVLKQNVHVFGVEGNSDELDEPIKTVFADVA
FVKKHNLMSLNSINWSRVLVQMAHHFFAYFQCTPSLDTHPLPLVEVVVPTGAAGNLAAGYIAQKIGLPIR
LVVAVNRNDIIHRTVQQGDFSLSEAVKSTLASAMDIQVPYNMERVFWLLSGSDSQVTRALMEQFERTQSV
NLPKELHSKLSEAVTSVSVSDEAITQTMGRCWDENQYLLCPHSAVAVNYHYQQIDRQQPSTPRCCLAPAS
AAKFPEAVLAAGLTPETPAEIVALEHKETRCTLMRRGDNWMLMLRDTIEDLSRQWRSHALNTSQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060741
RefSeq Size 2150
RefSeq ORF 1452
Synonyms SOFAT; THS2; TSH2
Locus ID 55258
UniProt ID Q86YJ6
Cytogenetics 2p11.2
Summary This gene encodes a threonine synthase-like protein. A similar enzyme in mouse can catalyze the degradation of O-phospho-homoserine to a-ketobutyrate, phosphate, and ammonia. This protein also has phospho-lyase activity on both gamma and beta phosphorylated substrates. In mouse an alternatively spliced form of this protein has been shown to act as a cytokine and can induce the production of the inflammatory cytokine IL6 in osteoblasts. Alternate splicing results in multiple transcript variants. provided by RefSeq, Sep 2011
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "THNSL2" proteins (3)
SKU Description Size Price
LC413167 Lyophilized THNSL2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY413167 Transient overexpression lysate of threonine synthase-like 2 (S. cerevisiae) (THNSL2) (as WB positive control) 100 ug
$665.00
TP309049 Recombinant protein of human threonine synthase-like 2 (S. cerevisiae) (THNSL2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products