CSDC2 (NM_014460) Human Mass Spec Standard

CAT#: PH308989

CSDC2 MS Standard C13 and N15-labeled recombinant protein (NP_055275)

Product Images

Coomassie blue staining of purified CSDC2 protein (Cat# TP308989). The protein was produced from HEK293T cells transfected with CSDC2 cDNA clone (Cat# RC208989) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC208989
• Predicted MW: 16.8 kDa
• Protein Sequence:
  Sequence Link

  >RC208989 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTSESTSPPVVPPLHSPKSPVWPTFPFHREGSRVWERGGVPPRDLPSPLPTKRTRTYSATARASAGPVFK
  GVCKQFSRSQGHGFITPENGSEDIFVHVSDIEGEYVPVEGDEVTYKMCPIPPKNQKFQAVEVVLTQLAPH
  TPHETWSGQVVGS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_055275
• RefSeq Size: 2545
• RefSeq ORF: 459
• Synonyms: dJ347H13.2; PIPPIN
• Locus ID: 27254
• UniProt ID: Q9Y534
• Cytogenetics: 22q13.2
• Summary: RNA-binding factor which binds specifically to the very 3' UTR ends of both histone H1 and H3.3 mRNAs, encompassing the polyadenylation signal. Might play a central role in the negative regulation of histone variant synthesis in the developing brain (By similarity).[UniProtKB/Swiss-Prot Function]
• Protein Families: Transcription Factors