OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CSDC2 (NM_014460) Human Mass Spec Standard

Be the first to review this product
SKU
PH308989
CSDC2 MS Standard C13 and N15-labeled recombinant protein (NP_055275)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA343811 Rabbit Polyclonal Anti-CSDC2 Antibody
100 ul
$525.00
LY415263 Transient overexpression lysate of cold shock domain containing C2, RNA binding (CSDC2) (as WB positive control) 100 ug
$436.00

Other products for "CSDC2 or NM_014460"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC208989
Predicted MW 16.8 kDa
Protein Sequence
Protein Sequence
>RC208989 protein sequence
Red=Cloning site Green=Tags(s)

MTSESTSPPVVPPLHSPKSPVWPTFPFHREGSRVWERGGVPPRDLPSPLPTKRTRTYSATARASAGPVFK
GVCKQFSRSQGHGFITPENGSEDIFVHVSDIEGEYVPVEGDEVTYKMCPIPPKNQKFQAVEVVLTQLAPH
TPHETWSGQVVGS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_055275
RefSeq Size 2545
RefSeq ORF 459
Synonyms dJ347H13.2; PIPPIN
Locus ID 27254
UniProt ID Q9Y534
Cytogenetics 22q13.2
Summary RNA-binding factor which binds specifically to the very 3' UTR ends of both histone H1 and H3.3 mRNAs, encompassing the polyadenylation signal. Might play a central role in the negative regulation of histone variant synthesis in the developing brain (By similarity).UniProtKB/Swiss-Prot Function
Protein Families Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CSDC2" proteins (4)
SKU Description Size Price
LC415263 Lyophilized CSDC2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415263 Transient overexpression lysate of cold shock domain containing C2, RNA binding (CSDC2) (as WB positive control) 100 ug
$436.00
TP308989 Recombinant protein of human cold shock domain containing C2, RNA binding (CSDC2), 20 µg 20 ug
$867.00
TP710146 Recombinant protein of human cold shock domain containing C2, RNA binding (CSDC2), full length, with C-terminal DDK tag, expressed in sf9, 20ug 20 ug
$540.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products