RDH10 (NM_172037) Human Mass Spec Standard

CAT#: PH308980

RDH10 MS Standard C13 and N15-labeled recombinant protein (NP_742034)

Product Images

Coomassie blue staining of purified RDH10 protein (Cat# TP308980). The protein was produced from HEK293T cells transfected with RDH10 cDNA clone (Cat# RC208980) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC208980
• Predicted MW: 38.1 kDa
• Protein Sequence:
  Sequence Link

  >RC208980 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MNIVVEFFVVTFKVLWAFVLAAARWLVRPKEKSVAGQVCLITGAGSGLGRLFALEFARRRALLVLWDINT
  QSNEETAGMVRHIYRDLEAADAAALQAGNGEEEILPHCNLQVFTYTCDVGKRENVYLTAERVRKEVGEVS
  VLVNNAGVVSGHHLLECPDELIERTMMVNCHAHFWTTKAFLPTMLEINHGHIVTVASSLGLFSTAGVEDY
  CASKFGVVGFHESLSHELKAAEKDGIKTTLVCPYLVDTGMFRGCRIRKEIEPFLPPLKPDYCVKQAMKAI
  LTDQPMICTPRLMYIVTFMKSILPFEAVVCMYRFLGADKCMYPFIAQRKQATNNNEAKNGI
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_742034
• RefSeq Size: 3981
• RefSeq ORF: 1023
• Synonyms: SDR16C4
• Locus ID: 157506
• UniProt ID: Q8IZV5, A0A024R7X6
• Cytogenetics: 8q21.11
• Summary: This gene encodes a retinol dehydrogenase, which converts all-trans-retinol to all-trans-retinal, with preference for NADP as a cofactor. Studies in mice suggest that this protein is essential for synthesis of embryonic retinoic acid and is required for limb, craniofacial, and organ development. [provided by RefSeq, Dec 2011]
• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Metabolic pathways, Retinol metabolism