OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Adenine Nucleotide Translocator 2 (SLC25A5) (NM_001152) Human Mass Spec Standard

Be the first to review this product
SKU
PH308949
SLC25A5 MS Standard C13 and N15-labeled recombinant protein (NP_001143)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA381615 SLC25A5 Rabbit polyclonal Antibody
100 ul
$410.00
LY420098 Transient overexpression lysate of solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 5 (SLC25A5), nuclear gene encoding mitochondrial protein (as WB positive control) 100 ug
$436.00

Other products for "Adenine Nucleotide Translocator 2 or NM_001152"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC208949
Predicted MW 32.9 kDa
Protein Sequence
Protein Sequence
>RC208949 protein sequence
Red=Cloning site Green=Tags(s)

MTDAAVSFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVRIPKEQGVLSF
WRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWRYFAGNLASGGAAGATSLCFVYPLDFARTR
LAADVGKAGAEREFRGLGDCLVKIYKSDGIKGLYQGFNVSVQGIIIYRAAYFGIYDTAKGMLPDPKNTHI
VISWMIAQTVTAVAGLTSYPFDTVRRRMMMQSGRKGTDIMYTGTLDCWRKIARDEGGKAFFKGAWSNVLR
GMGGAFVLVLYDEIKKYT

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001143
RefSeq Size 1351
RefSeq ORF 894
Synonyms 2F1; AAC2; ANT2; T2; T3
Locus ID 292
UniProt ID P05141
Cytogenetics Xq24
Summary This gene is a member of the mitochondrial carrier subfamily of solute carrier protein genes. The product of this gene functions as a gated pore that translocates ADP from the cytoplasm into the mitochondrial matrix and ATP from the mitochondrial matrix into the cytoplasm. The protein forms a homodimer embedded in the inner mitochondria membrane. Suppressed expression of this gene has been shown to induce apoptosis and inhibit tumor growth. The human genome contains several non-transcribed pseudogenes of this gene.provided by RefSeq, Jun 2013
Protein Families Druggable Genome, Transmembrane
Protein Pathways Calcium signaling pathway, Huntington's disease, Parkinson's disease
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Adenine Nucleotide Translocator 2" proteins (4)
SKU Description Size Price
LC420098 Lyophilized SLC25A5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY420098 Transient overexpression lysate of solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 5 (SLC25A5), nuclear gene encoding mitochondrial protein (as WB positive control) 100 ug
$436.00
TP308949 Recombinant protein of human solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 5 (SLC25A5), nuclear gene encoding mitochondrial protein, 20 µg 20 ug
$867.00
TP761831 Purified recombinant protein of human ADP/ATP translocase 2(SLC25A5), full length with N-terminal GST and C-terminal His tag, expressed in E.coli, 50ug 50 ug
$270.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products