OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Adenine Nucleotide Translocator 2 (SLC25A5) (NM_001152) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP308949
Recombinant protein of human solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 5 (SLC25A5), nuclear gene encoding mitochondrial protein, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
5 Days*
Bulk/Customize

Frequently Bought Together (2)

TA381615 SLC25A5 Rabbit polyclonal Antibody
100 ul
$410.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Adenine Nucleotide Translocator 2 or NM_001152"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC208949 protein sequence
Red=Cloning site Green=Tags(s)

MTDAAVSFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVRIPKEQGVLSF
WRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWRYFAGNLASGGAAGATSLCFVYPLDFARTR
LAADVGKAGAEREFRGLGDCLVKIYKSDGIKGLYQGFNVSVQGIIIYRAAYFGIYDTAKGMLPDPKNTHI
VISWMIAQTVTAVAGLTSYPFDTVRRRMMMQSGRKGTDIMYTGTLDCWRKIARDEGGKAFFKGAWSNVLR
GMGGAFVLVLYDEIKKYT

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 32.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Bioactivity Pull-down assay (PMID: 28368390)
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001143
Locus ID 292
UniProt ID P05141
Cytogenetics Xq24
RefSeq Size 1351
RefSeq ORF 894
Synonyms 2F1; AAC2; ANT2; T2; T3
Summary This gene is a member of the mitochondrial carrier subfamily of solute carrier protein genes. The product of this gene functions as a gated pore that translocates ADP from the cytoplasm into the mitochondrial matrix and ATP from the mitochondrial matrix into the cytoplasm. The protein forms a homodimer embedded in the inner mitochondria membrane. Suppressed expression of this gene has been shown to induce apoptosis and inhibit tumor growth. The human genome contains several non-transcribed pseudogenes of this gene.provided by RefSeq, Jun 2013
Protein Categories Membrane Proteins
Protein Families Druggable Genome, Transmembrane
Protein Pathways Calcium signaling pathway, Huntington's disease, Parkinson's disease
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Adenine Nucleotide Translocator 2" proteins (4)
SKU Description Size Price
PH308949 SLC25A5 MS Standard C13 and N15-labeled recombinant protein (NP_001143) 10 ug
$3,360.00
LC420098 Lyophilized SLC25A5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY420098 Transient overexpression lysate of solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 5 (SLC25A5), nuclear gene encoding mitochondrial protein (as WB positive control) 100 ug
$436.00
TP761831 Purified recombinant protein of human ADP/ATP translocase 2(SLC25A5), full length with N-terminal GST and C-terminal His tag, expressed in E.coli, 50ug 50 ug
$270.00

file-alt Citations

Rabdosianone I, a Bitter Diterpene from an Oriental Herb, Suppresses Thymidylate Synthase Expression by Directly Binding to ANT2 and PHB2
Watanabe, Yamada, Kurumida et al
Cancers (Basel) (2021) 13 (5) DOI: 10.3390/cancers13050982
Cited by 7
AI Summary: OriGene products—purified recombinant human ANT2 (catalog No: TP308949) and PHB2 (catalog No: TP760501)—were used in this study to investigate and confirm the direct binding of rabdosianone I to its protein targets, supporting the discovery of its mechanism in suppressing thymidylate synthase expression.
Snippet: to make stock solutions. Purified recombinant human ANT2 (Homo sapiens solute carrier family 25, member 5, catalog No: TP308949) and PHB2 (Human prohibitin 2, catalog No: TP760501) were obtained from OriGene (Rockville, MD, USA). 4.2. Cell Lines and Culture The human colorectal cancer cell lines HT-29, HCT116, and HCT-15 were obtained as NCI-60 cell lines from the NCI Developmental Therapeutics P
FigureFigureFigure
The pleiotropic regulation of cyclin D1 by newly identified sesaminol-binding protein ANT2
Watanabe, Iizumi, Sukeno et al
Oncogenesis (2017) 6 (4), e311 DOI: 10.1038/oncsis.2017.10
AI Summary: OriGene's purified recombinant Homo sapiens ANT2 protein (catalog number TP308949) was used in this study to investigate and confirm the direct binding of sesaminol to ANT2, helping elucidate the molecular mechanism by which sesaminol regulates cyclin D1 expression.
Snippet: Valinomycin was obtained from Sigma (Saint Louis, MO, USA). These reagents were dissolved in the solvent dimethyl sulfoxide as stock. Purified recombinant protein of Homo sapiens ANT2 (SLC25A5) was obtained from OriGene (TP308949;Rockville, MD, USA). ... All 2 versions Cite SaveSaving
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products