PLVAP (NM_031310) Human Mass Spec Standard

CAT#: PH308914

PLVAP MS Standard C13 and N15-labeled recombinant protein (NP_112600)

Product Images

Coomassie blue staining of purified PLVAP protein (Cat# TP308914). The protein was produced from HEK293T cells transfected with PLVAP cDNA clone (Cat# RC208914) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC208914
• Predicted MW: 50.4 kDa
• Protein Sequence:
  Sequence Link

  >RC208914 representing NM_031310
  Red=Cloning site Green=Tags(s)
  
  MGLAMEHGGSYARAGGSSRGCWYYLRYFFLFVSLIQFLIILGLVLFMVYGNVHVSTESNLQATERRAEGL
  YSQLLGLTASQSNLTKELNFTTRAKDAIMQMWLNARRDLDRINASFRQCQGDRVIYTNNQRYMAAIILSE
  KQCRDQFKDMNKSCDALLFMLNQKVKTLEVEIAKEKTICTKDKESVLLNKRVAEEQLVECVKTRELQHQE
  RQLAKEQLQKVQALCLPLDKDKFEMDLRNLWRDSIIPRSLDNLGYNLYHPLGSELASIRRACDHMPSLMS
  SKVEELARSLRADIERVARENSDLQRQKLEAQQGLRASQEAKQKVEKEAQAREAKLQAECSRQTQLALEE
  KAVLRKERDNLAKELEEKKREAEQLRMELAIRNSALDTCIKTKSQPMMPVSRPMGPVPNPQPIDPASLEE
  FKRKILESQRPPAGIPVAPSSG
  
  SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_112600
• RefSeq Size: 2317
• RefSeq ORF: 1326
• Synonyms: DIAR10; FELS; gp68; PV-1; PV1
• Locus ID: 83483
• UniProt ID: Q9BX97
• Cytogenetics: 19p13.11
• Summary: Endothelial cell-specific membrane protein involved in the formation of the diaphragms that bridge endothelial fenestrae. It is also required for the formation of stomata of caveolae and transendothelial channels. Functions in microvascular permeability, endothelial fenestrae contributing to the passage of water and solutes and regulating transcellular versus paracellular flow in different organs. Plays a specific role in embryonic development.[UniProtKB/Swiss-Prot Function]
• Protein Families: Transmembrane