OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DCUN1D2 (NM_001014283) Human Mass Spec Standard

Be the first to review this product
SKU
PH308865
DCUN1D2 MS Standard C13 and N15-labeled recombinant protein (NP_001014305)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY423049 Transient overexpression lysate of DCN1, defective in cullin neddylation 1, domain containing 2 (S. cerevisiae) (DCUN1D2) (as WB positive control) 100 ug
$436.00

Other products for "DCUN1D2 or NM_001014283"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC208865
Predicted MW 30.2 kDa
Protein Sequence
Protein Sequence
>RC208865 protein sequence
Red=Cloning site Green=Tags(s)

MHKLKSSQKDKVRQFMACTQAGERTAIYCLTQNEWRLDEATDSFFQNPDSLHRESMRNAVDKKKLERLYG
RYKDPQDENKIGVDGIQQFCDDLSLDPASISVLVIAWKFRAATQCEFSRKEFLDGMTELGCDSMEKLKAL
LPRLEQELKDTAKFKDFYQFTFTFAKNPGQKGLDLEMAVAYWKLVLSGRFKFLDLWNTFLMEHHKRSIPR
DTWNLLLDFGNMIADDMSNYDEEGAWPVLIDDFVEYARPVVTGGKRSLF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001014305
RefSeq Size 3046
RefSeq ORF 777
Synonyms C13orf17
Locus ID 55208
UniProt ID Q6PH85
Cytogenetics 13q34
Summary Potently stimulates the neddylation of cullin components of SCF-type E3 ubiquitin ligase complexes from the NEDD8-conjugating E2 enzyme UBC12. Neddylation of cullins play an essential role in the regulation of SCF-type complexes activity.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "DCUN1D2" proteins (3)
SKU Description Size Price
LC423049 Lyophilized DCUN1D2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY423049 Transient overexpression lysate of DCN1, defective in cullin neddylation 1, domain containing 2 (S. cerevisiae) (DCUN1D2) (as WB positive control) 100 ug
$436.00
TP308865 Recombinant protein of human DCN1, defective in cullin neddylation 1, domain containing 2 (S. cerevisiae) (DCUN1D2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products