PCBD2 (NM_032151) Human Mass Spec Standard

CAT#: PH308859

PCBD2 MS Standard C13 and N15-labeled recombinant protein (NP_115527)

Product Images

Coomassie blue staining of purified PCBD2 protein (Cat# TP308859). The protein was produced from HEK293T cells transfected with PCBD2 cDNA clone (Cat# RC208859) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC208859
• Predicted MW: 14.4 kDa
• Protein Sequence:
  Sequence Link

  >RC208859 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAVLGALGATRRLLAALRGQSLGLAAMSSGTHRLTAEERNQAILDLKAAGWSELSERDAIYKEFSFHNF
  NQAFGFMSRVALQAEKMNHHPEWFNVYNKVQITLTSHDCGELTKKDVKLAKFIEKAAASV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_115527
• RefSeq Size: 2395
• RefSeq ORF: 390
• Synonyms: DCOH2; DCOHM; PHS2
• Locus ID: 84105
• UniProt ID: Q9H0N5
• Cytogenetics: 5q31.1
• Summary: Involved in tetrahydrobiopterin biosynthesis. Seems to both prevent the formation of 7-pterins and accelerate the formation of quinonoid-BH2 (By similarity).[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome, Transcription Factors