OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CSP (DNAJC5) (NM_025219) Human Mass Spec Standard

Be the first to review this product
SKU
PH308826
DNAJC5 MS Standard C13 and N15-labeled recombinant protein (NP_079495)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA375536 DNAJC5 Rabbit polyclonal Antibody
100 ul
$410.00
LY410833 Transient overexpression lysate of DnaJ (Hsp40) homolog, subfamily C, member 5 (DNAJC5) (as WB positive control) 100 ug
$436.00

Other products for "CSP or NM_025219"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC208826
Predicted MW 22 kDa
Protein Sequence
Protein Sequence
>RC208826 representing NM_025219
Red=Cloning site Green=Tags(s)

MADQRQRSLSTSGESLYHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDNPEAADKFKEINNAHAILTDA
TKRNIYDKYGSLGLYVAEQFGEENVNTYFVLSSWWAKALFVFCGLLTCCYCCCCLCCCFNCCCGKCKPKA
PEGEETEFYVSPEDLEAQLQSDEREATDTPIVIQPASATETTQLTADSHPSYHTDGFN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_079495
RefSeq Size 3286
RefSeq ORF 594
Synonyms CLN4; CLN4B; CSP; DNAJC5A; mir-941-2; mir-941-3; mir-941-4; mir-941-5; NCL
Locus ID 80331
UniProt ID Q9H3Z4
Cytogenetics 20q13.33
Summary This gene is a member of the J protein family. J proteins function in many cellular processes by regulating the ATPase activity of 70 kDa heat shock proteins. The encoded protein plays a role in membrane trafficking and protein folding, and has been shown to have anti-neurodegenerative properties. The encoded protein is known to play a role in cystic fibrosis and Huntington's disease. A pseudogene of this gene is located on the short arm of chromosome 8. provided by RefSeq, Nov 2010
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CSP" proteins (3)
SKU Description Size Price
LC410833 Lyophilized DNAJC5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY410833 Transient overexpression lysate of DnaJ (Hsp40) homolog, subfamily C, member 5 (DNAJC5) (as WB positive control) 100 ug
$436.00
TP308826 Recombinant protein of human DnaJ (Hsp40) homolog, subfamily C, member 5 (DNAJC5), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products