OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DCUN1D4 (NM_015115) Human Mass Spec Standard

Be the first to review this product
SKU
PH308821
DCUN1D4 MS Standard C13 and N15-labeled recombinant protein (NP_055930)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA334980 Rabbit Polyclonal Anti-DCUN1D4 Antibody
100 ul
$585.00
LY414778 Transient overexpression lysate of DCN1, defective in cullin neddylation 1, domain containing 4 (S. cerevisiae) (DCUN1D4), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "DCUN1D4 or NM_015115"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC208821
Predicted MW 30 kDa
Protein Sequence
Protein Sequence
>RC208821 protein sequence
Red=Cloning site Green=Tags(s)

MHSDAAAVNFQLNSHLSTLANIHKIYHTLNKLNLTEDIGQDDHQTGSLRSCSSSDCFNKVMPPRKKRRPA
SGDDLSAKKSRHDSMYRKYDSTRIKTEEEAFSSKRCLEWFYEYAGTDDVVGPEGMEKFCEDIGVEPENVV
MLVLAWKLDAQNMGYFTLQEWLKGMTSLQCDTTEKLRNTLDYLRSFLNDSTNFKLIYRYAFDFARQSKYK
VINKDQWCNVLEFSRTINLDLSNYDEDGAWPVLLDEFVEWYKDKQMS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_055930
RefSeq Size 4283
RefSeq ORF 771
Locus ID 23142
UniProt ID Q92564
Cytogenetics 4q12
Summary Contributes to the neddylation of all cullins by transfering NEDD8 from N-terminally acetylated NEDD8-conjugating E2s enzyme to different cullin C-terminal domain-RBX complexes which are necessary for the activation of cullin-RING E3 ubiquitin ligases (CRLs).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "DCUN1D4" proteins (5)
SKU Description Size Price
LC414778 Lyophilized DCUN1D4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421741 Lyophilized DCUN1D4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY414778 Transient overexpression lysate of DCN1, defective in cullin neddylation 1, domain containing 4 (S. cerevisiae) (DCUN1D4), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY421741 Transient overexpression lysate of DCN1, defective in cullin neddylation 1, domain containing 4 (S. cerevisiae) (DCUN1D4), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP308821 Recombinant protein of human DCN1, defective in cullin neddylation 1, domain containing 4 (S. cerevisiae) (DCUN1D4), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products