OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

LIN7C (NM_018362) Human Mass Spec Standard

Be the first to review this product
SKU
PH308758
LIN7C MS Standard C13 and N15-labeled recombinant protein (NP_060832)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA356244 LIN7C Antibody - N-terminal region
100 ul
$585.00
LY413114 Transient overexpression lysate of lin-7 homolog C (C. elegans) (LIN7C) (as WB positive control) 100 ug
$436.00

Other products for "LIN7C or NM_018362"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC208758
Predicted MW 21.7 kDa
Protein Sequence
Protein Sequence
>RC208758 representing NM_018362
Red=Cloning site Green=Tags(s)

MAALGEPVRLERDICRAIELLEKLQRSGEVPPQKLQALQRVLQSEFCNAVREVYEHVYETVDISSSPEVR
ANATAKATVAAFAASEGHSHPRVVELPKTEEGLGFNIMGGKEQNSPIYISRIIPGGIADRHGGLKRGDQL
LSVNGVSVEGEHHEKAVELLKAAQGKVKLVVRYTPKVLEEMESRFEKMRSAKRRQQT

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060832
RefSeq Size 4729
RefSeq ORF 591
Synonyms LIN-7-C; LIN-7C; MALS-3; MALS3; VELI3
Locus ID 55327
UniProt ID Q9NUP9
Cytogenetics 11p14.1
Summary Plays a role in establishing and maintaining the asymmetric distribution of channels and receptors at the plasma membrane of polarized cells. Forms membrane-associated multiprotein complexes that may regulate delivery and recycling of proteins to the correct membrane domains. The tripartite complex composed of LIN7 (LIN7A, LIN7B or LIN7C), CASK and APBA1 may have the potential to couple synaptic vesicle exocytosis to cell adhesion in brain. Ensures the proper localization of GRIN2B (subunit 2B of the NMDA receptor) to neuronal postsynaptic density and may function in localizing synaptic vesicles at synapses where it is recruited by beta-catenin and cadherin. Required to localize Kir2 channels, GABA transporter (SLC6A12) and EGFR/ERBB1, ERBB2, ERBB3 and ERBB4 to the basolateral membrane of epithelial cells.UniProtKB/Swiss-Prot Function
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "LIN7C" proteins (3)
SKU Description Size Price
LC413114 Lyophilized LIN7C HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY413114 Transient overexpression lysate of lin-7 homolog C (C. elegans) (LIN7C) (as WB positive control) 100 ug
$436.00
TP308758 Recombinant protein of human lin-7 homolog C (C. elegans) (LIN7C), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products