OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

BRD7 (NM_013263) Human Mass Spec Standard

Be the first to review this product
SKU
PH308734
BRD7 MS Standard C13 and N15-labeled recombinant protein (NP_037395)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA369838 BRD7 rabbit polyclonal antibody
100 ul
$310.00
LY433395 Transient overexpression lysate of bromodomain containing 7 (BRD7), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "BRD7 or NM_013263"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC208734
Predicted MW 74.1 kDa
Protein Sequence
Protein Sequence
>RC208734 protein sequence
Red=Cloning site Green=Tags(s)

MGKKHKKHKSDKHLYEEYVEKPLKLVLKVGGNEVTELSTGSSGHDSSLFEDKNDHDKHKDRKRKKRKKGE
KQIPGEEKGRKRRRVKEDKKKRDRDRVENEAEKDLQCHAPVRLDLPPEKPLTSSLAKQEEVEQTPLQEAL
NQLMRQLQRKDPSAFFSFPVTDFIAPGYSMIIKHPMDFSTMKEKIKNNDYQSIEELKDNFKLMCTNAMIY
NKPETIYYKAAKKLLHSGMKILSQERIQSLKQSIDFMADLQKTRKQKDGTDTSQSGEDGGCWQREREDSG
DAEAHAFKSPSKENKKKDKDMLEDKFKSNNLEREQEQLDRIVKESGGKLTRRLVNSQCEFERRKPDGTTT
LGLLHPVDPIVGEPGYCPVRLGMTTGRLQSGVNTLQGFKEDKRNKVTPVLYLNYGPYSSYAPHYDSTFAN
ISKDDSDLIYSTYGEDSDLPSDFSIHEFLATCQDYPYVMADSLLDVLTKGGHSRTLQEMEMSLPEDEGHT
RTLDTAKEMEITEVEPPGRLDSSTQDRLIALKAVTNFGVPVEVFDSEEAEIFQKKLDETTRLLRELQEAQ
NERLSTRPPPNMICLLGPSYREMHLAEQVTNNLKELAQQVTPGDIVSTYGVRKAMGISIPSPVMENNFVD
LTEDTEEPKKTDVAECGPGGS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_037395
RefSeq Size 2327
RefSeq ORF 1953
Synonyms BP75; CELTIX1; NAG4
Locus ID 29117
UniProt ID Q9NPI1
Cytogenetics 16q12.1
Summary This gene encodes a protein which is a member of the bromodomain-containing protein family. The product of this gene has been identified as a component of one form of the SWI/SNF chromatin remodeling complex, and as a protein which interacts with p53 and is required for p53-dependent oncogene-induced senescence which prevents tumor growth. Pseudogenes have been described on chromosomes 2, 3, 6, 13 and 14. Alternative splicing results in multiple transcript variants. provided by RefSeq, Jul 2010
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "BRD7" proteins (5)
SKU Description Size Price
LC415698 Lyophilized BRD7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC433395 Lyophilized BRD7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415698 Transient overexpression lysate of bromodomain containing 7 (BRD7) (as WB positive control) 100 ug
$436.00
LY433395 Transient overexpression lysate of bromodomain containing 7 (BRD7), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP308734 Recombinant protein of human bromodomain containing 7 (BRD7), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products