OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SASH3 (NM_018990) Human Mass Spec Standard

Be the first to review this product
SKU
PH308714
SASH3 MS Standard C13 and N15-labeled recombinant protein (NP_061863)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA344828 Rabbit Polyclonal Anti-CXorf9 Antibody - C-terminal region
100 ul
$585.00
LY412828 Transient overexpression lysate of SAM and SH3 domain containing 3 (SASH3) (as WB positive control) 100 ug
$436.00

Other products for "SASH3 or NM_018990"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC208714
Predicted MW 41.6 kDa
Protein Sequence
Protein Sequence
>RC208714 protein sequence
Red=Cloning site Green=Tags(s)

MLRRKPSNASEKEPTQKKKLSLQRSSSFKDFAKSKPSSPVVSEKEFNLDDNIPEDDSGVPTPEDAGKSGK
KLGKKWRAVISRTMNRKMGKMMVKALSEEMADTLEEGSASPTSPDYSLDSPGPEKMALAFSEQEEHELPV
LSRQASTGSELCSPSPGSGSFGEEPPAPQYTGPFCGRARVHTDFTPSPYDHDSLKLQKGDVIQIIEKPPV
GTWLGLLNGKVGSFKFIYVDVLPEEAVGHARPSRRQSKGKRPKPKTLHELLERIGLEEHTSTLLLNGYQT
LEDFKELRETHLNELNIMDPQHRAKLLTAAELLLDYDTGSEEAEEGAESSQEPVAHTVSEPKVDIPRDSG
CFEGSESGRDDAELAGTEEQLQGLSLAGAP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_061863
RefSeq Size 2707
RefSeq ORF 1140
Synonyms 753P9; CXorf9; HACS2; SH3D6C; SLY
Locus ID 54440
UniProt ID O75995
Cytogenetics Xq26.1
Summary The protein encoded by this gene contains a Src homology-3 (SH3) domain and a sterile alpha motif (SAM), both of which are found in proteins involved in cell signaling. This protein may function as a signaling adapter protein in lymphocytes.provided by RefSeq, Sep 2009
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SASH3" proteins (3)
SKU Description Size Price
LC412828 Lyophilized SASH3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY412828 Transient overexpression lysate of SAM and SH3 domain containing 3 (SASH3) (as WB positive control) 100 ug
$436.00
TP308714 Recombinant protein of human SAM and SH3 domain containing 3 (SASH3), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products