SASH3 (NM_018990) Human Mass Spec Standard

CAT#: PH308714

SASH3 MS Standard C13 and N15-labeled recombinant protein (NP_061863)

Product Images

Coomassie blue staining of purified SASH3 protein (Cat# TP308714). The protein was produced from HEK293T cells transfected with SASH3 cDNA clone (Cat# RC208714) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC208714
• Predicted MW: 41.6 kDa
• Protein Sequence:
  Sequence Link

  >RC208714 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLRRKPSNASEKEPTQKKKLSLQRSSSFKDFAKSKPSSPVVSEKEFNLDDNIPEDDSGVPTPEDAGKSGK
  KLGKKWRAVISRTMNRKMGKMMVKALSEEMADTLEEGSASPTSPDYSLDSPGPEKMALAFSEQEEHELPV
  LSRQASTGSELCSPSPGSGSFGEEPPAPQYTGPFCGRARVHTDFTPSPYDHDSLKLQKGDVIQIIEKPPV
  GTWLGLLNGKVGSFKFIYVDVLPEEAVGHARPSRRQSKGKRPKPKTLHELLERIGLEEHTSTLLLNGYQT
  LEDFKELRETHLNELNIMDPQHRAKLLTAAELLLDYDTGSEEAEEGAESSQEPVAHTVSEPKVDIPRDSG
  CFEGSESGRDDAELAGTEEQLQGLSLAGAP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_061863
• RefSeq Size: 2707
• RefSeq ORF: 1140
• Synonyms: 753P9; CXorf9; HACS2; SH3D6C; SLY
• Locus ID: 54440
• UniProt ID: O75995
• Cytogenetics: Xq26.1
• Summary: The protein encoded by this gene contains a Src homology-3 (SH3) domain and a sterile alpha motif (SAM), both of which are found in proteins involved in cell signaling. This protein may function as a signaling adapter protein in lymphocytes.[provided by RefSeq, Sep 2009]