OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CA13 (NM_198584) Human Mass Spec Standard

Be the first to review this product
SKU
PH308607
CA13 MS Standard C13 and N15-labeled recombinant protein (NP_940986)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA374170 CA13 Rabbit polyclonal Antibody
100 ul
$410.00
LY404835 Transient overexpression lysate of carbonic anhydrase XIII (CA13) (as WB positive control) 100 ug
$436.00

Other products for "CA13 or NM_198584"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC208607
Predicted MW 29.4 kDa
Protein Sequence
Protein Sequence
>RC208607 protein sequence
Red=Cloning site Green=Tags(s)

MSRLSWGYREHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKIISNSGHSFNVD
FDDTENKSVLRGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAAELHVVHWNSDKYPSFVEAAHEPD
GLAVLGVFLQIGEPNSQLQKITDTLDSIKEKGKQTRFTNFDLLSLLPPSWDYWTYPGSLTVPPLLESVTW
IVLKQPINISSQQLAKFRSLLCTAEGEAAAFLVSNHRPPQPLKGRKVRASFH

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_940986
RefSeq Size 3855
RefSeq ORF 786
Synonyms CAXIII
Locus ID 377677
UniProt ID Q8N1Q1
Cytogenetics 8q21.2
Summary Carbonic anhydrases (CAs) are a family of zinc metalloenzymes. For background information on the CA family, see MIM 114800.supplied by OMIM, Mar 2008
Protein Families Druggable Genome
Protein Pathways Nitrogen metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CA13" proteins (4)
SKU Description Size Price
LC404835 Lyophilized CA13 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY404835 Transient overexpression lysate of carbonic anhydrase XIII (CA13) (as WB positive control) 100 ug
$436.00
TP308607 Recombinant protein of human carbonic anhydrase XIII (CA13), 20 µg 20 ug
$867.00
TP720089 Recombinant protein of human carbonic anhydrase XIII (CA13) 10 ug
$205.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products